[GigaCourse.Com] Udemy - Ultimate AWS Certified Security Specialty [NEW 2023] SCS-C01 |
0/2 |
5.0 GB |
|
/4. Domain 2 - Logging and Monitoring/35. [SAA] CloudTrail.mp4 |
27.4 MB |
/4. Domain 2 - Logging and Monitoring/35. [SAA] CloudTrail.srt |
14.5 KB |
/4. Domain 2 - Logging and Monitoring/36. [CCPSAADVASOA] CloudTrail Hands On.mp4 |
13.6 MB |
/4. Domain 2 - Logging and Monitoring/36. [CCPSAADVASOA] CloudTrail Hands On.srt |
3.2 KB |
/4. Domain 2 - Logging and Monitoring/37. [SOA] CloudTrail for SysOps.mp4 |
16.3 MB |
Showing first 5 matched files of 444 total files |
Ultimate AWS Certified Security Specialty [NEW 2023] SCS-C01 |
5/1 |
5.1 GB |
|
|
14.5 KB |
|
2.0 KB |
|
7.2 KB |
|
3.2 KB |
|
27.4 MB |
Showing first 5 matched files of 649 total files |
[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02 |
4/0 |
4.4 GB |
|
|
17.2 MB |
|
6.6 KB |
/13 - Management and Security/011 [HOL] Create a CloudTrail Trail.mp4 |
27.8 MB |
/13 - Management and Security/011 [HOL] Create a CloudTrail Trail_en.srt |
6.6 KB |
Showing first 4 matched files of 411 total files |
[ DevCourseWeb.com ] AWS Certified Solutions Architect Associate WARP 9 |
0/1 |
1.5 GB |
|
|
16.2 MB |
/~Get Your Files Here !/09 - 4 Security/006 CLOUDTRAIL_en.srt |
6.2 KB |
/~Get Your Files Here !/10 - Security Demo/009 CloudTrail.mp4 |
11.3 MB |
Showing first 3 matched files of 220 total files |
AWS PowerShell Automation Compute and AWS EC2 Tutorial - AWS Training |
7/5 |
15.6 GB |
|
|
177.8 MB |
Showing first 1 matched files of 133 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
40.3 MB |
|
10.0 KB |
Showing first 2 matched files of 612 total files |
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
/05 - Monitoring and Logging (Domain 3)/002 CloudTrail - Overview.mkv |
112.5 MB |
/05 - Monitoring and Logging (Domain 3)/003 CloudTrail - Log Integrity.mkv |
52.4 MB |
/05 - Monitoring and Logging (Domain 3)/004 CloudTrail - Cross Account Logging.mkv |
34.6 MB |
/05 - Monitoring and Logging (Domain 3)/022 CloudWatch Events - Integration with CloudTrail API.mkv |
19.6 MB |
Showing first 4 matched files of 242 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
1/0 |
10.3 GB |
|
/05 - Monitoring and Logging (Domain 3)/002 CloudTrail - Overview.mkv |
112.5 MB |
/05 - Monitoring and Logging (Domain 3)/003 CloudTrail - Log Integrity.mkv |
52.4 MB |
/05 - Monitoring and Logging (Domain 3)/004 CloudTrail - Cross Account Logging.mkv |
34.6 MB |
/05 - Monitoring and Logging (Domain 3)/022 CloudWatch Events - Integration with CloudTrail API.mkv |
19.6 MB |
Showing first 4 matched files of 234 total files |
7/1 |
3.5 GB |
||
/09 Management Tools/005 Learning about CloudTrail Basics.en.srt |
11.1 KB |
/09 Management Tools/005 Learning about CloudTrail Basics.mp4 |
99.2 MB |
Showing first 2 matched files of 130 total files |
13/4 |
13.5 GB |
||
|
53.3 KB |
|
381.6 MB |
Showing first 2 matched files of 108 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2023 - DOP-C02 |
9/2 |
10.5 GB |
|
GetFreeCourses.Co-Udemy-AWS Certified Cloud Practitioner 2022 Amazon Web Services |
5/1 |
6.1 GB |
|
/1. Introduction to AWS/10. Lab Session - AWS CloudTrail.mp4 |
71.1 MB |
/1. Introduction to AWS/10. Lab Session - AWS CloudTrail.srt |
7.4 KB |
Showing first 2 matched files of 145 total files |
ZV - Udemy - AWS Certified Advanced Networking - Specialty 2019 |
|
7.6 GB |
|
|
119.5 MB |
|
10.7 KB |
Showing first 2 matched files of 278 total files |
Udemy - Cloud Security per Ethical Hacker e Esperti in Sicurezza! [Ita] |
1/1 |
7.7 GB |
|
/5. Monitoraggio e Logging/11. [AWS CloudTrail] Introduzione.mp4 |
57.5 MB |
/5. Monitoraggio e Logging/12. [AWS CloudTrail] Laboratorio.mp4 |
59.5 MB |
/5. Monitoraggio e Logging/13. [AWS CloudTrail] Utilizzo tramite CLI.mp4 |
22.7 MB |
Showing first 3 matched files of 196 total files |
|
5.3 GB |
||
|
40.3 MB |
Showing first 1 matched files of 138 total files |
2/0 |
267.5 MB |
||
/[TutsNode.com] - Running Kubernetes on AWS EKS/22 Using CloudTrail and CloudWatch.en.srt |
4.8 KB |
/[TutsNode.com] - Running Kubernetes on AWS EKS/22 Using CloudTrail and CloudWatch.mp4 |
7.7 MB |
Showing first 2 matched files of 77 total files |
4/0 |
4.5 GB |
||
|
8.3 KB |
|
2.6 KB |
|
43.3 MB |
|
8.6 MB |
Showing first 4 matched files of 424 total files |
[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021 |
|
9.1 GB |
|
|
119.5 MB |
Showing first 1 matched files of 135 total files |
[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam] |
|
25.4 GB |
|
|
50.3 MB |
|
12.5 KB |
/20. AWS Auditing, Monitoring, and Notification Services/4. Introduction to AWS CloudTrail.mp4 |
118.4 MB |
/20. AWS Auditing, Monitoring, and Notification Services/4. Introduction to AWS CloudTrail.srt |
26.7 KB |
|
145.7 MB |
Showing first 5 matched files of 1023 total files |
|
11.5 GB |
||
/15 Monitoring Logging and Auditing/228 CloudWatch and CloudTrail Comparison.mp4 |
20.6 MB |
/15 Monitoring Logging and Auditing/236 Amazon CloudTrail Overview.mp4 |
19.0 MB |
/15 Monitoring Logging and Auditing/237 Amazon CloudTrail Console Walkthrough.mp4 |
23.8 MB |
Showing first 3 matched files of 275 total files |
Copyright © 2024 FileMood.com