|
[FreeCourseSite.com] Udemy - Unity C# Scripting Complete C# For Unity Game Development |
1/1 |
9.2 GB |
|
|
|
36.3 KB |
|
|
486.1 MB |
|
|
46.1 KB |
|
|
330.1 MB |
|
|
50.0 KB |
|
Showing first 5 matched files of 241 total files |
|
|
[FreeCourseSite.com] Udemy - Building Real-Time REST APIs with Spring Boot - Blog App |
1/0 |
7.6 GB |
|
|
/12 - Securing REST APIs/001 Note on WebSecurityConfigurerAdapter Deprecated in Latest Version.html |
1.0 KB |
|
Showing first 1 matched files of 364 total files |
|
|
8/1 |
88.6 GB |
||
|
/data/shaders/build/pc_dx12/deprecated_blendedmaterial.binrfx |
2.6 KB |
|
Showing first 1 matched files of 262 total files |
|
|
1/0 |
87.5 GB |
||
|
/data/shaders/build/pc_dx12/deprecated_blendedmaterial.binrfx |
2.6 KB |
|
Showing first 1 matched files of 251 total files |
|
|
[FreeCourseSite.com] Udemy - Ionic 6+ From Beginner to Advanced - Build Food Delivery App |
|
31.0 GB |
|
|
/09 - Ionic Components Overview/017 ion-slides (deprecated).html |
0.7 KB |
|
Showing first 1 matched files of 489 total files |
|
|
0/1 |
87.8 GB |
||
|
/AlanWake2/data/shaders/build/pc_dx12/deprecated_blendedmaterial.binrfx |
2.6 KB |
|
Showing first 1 matched files of 259 total files |
|
|
9/0 |
87.5 GB |
||
|
/data/shaders/build/pc_dx12/deprecated_blendedmaterial.binrfx |
2.6 KB |
|
Showing first 1 matched files of 256 total files |
|
|
|
87.5 GB |
||
|
/AlanWake2/data/shaders/build/pc_dx12/deprecated_blendedmaterial.binrfx |
2.6 KB |
|
Showing first 1 matched files of 253 total files |
|
|
|
134.5 GB |
||
|
|
6.1 GB |
|
Showing first 1 matched files of 25 total files |
|
|
[ FreeCourseWeb.com ] PluralSight - API Security with the OWASP API Security Top 10 |
3/1 |
229.1 MB |
|
|
/~Get Your Files Here !/11. Improper Inventory Management/2. Demo - Deprecated Functionality.mp4 |
4.6 MB |
|
/~Get Your Files Here !/11. Improper Inventory Management/2. Demo - Deprecated Functionality.vtt |
3.0 KB |
|
Showing first 2 matched files of 73 total files |
|
|
[FreeCourseSite.com] Udemy - [NEW] Spring Boot 3, Spring 6 & Hibernate for Beginners |
9/1 |
19.8 GB |
|
|
|
4.9 KB |
|
Showing first 1 matched files of 1200 total files |
|
|
Adobe Substance 3D Sampler v4.1.2.3298 (x64) + Fix {CracksHash} |
|
1.9 GB |
|
|
/Setup/products/SBSTA/Substance3DSampler1-core/1/Adobe Substance 3D Sampler/include/igl/deprecated.h |
0.8 KB |
|
Showing first 1 matched files of 4936 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
|
0.5 KB |
|
Showing first 1 matched files of 612 total files |
|
|
|
16.9 GB |
||
|
|
5.2 KB |
|
/BLES00058/PS3_GAME/USRDIR/SYSTEM/GL/ARB_FRAGMENT_PROGRAM/DEPRECATED/XRSHADER_SP_DST2_SPECNORMAL.FP |
5.0 KB |
|
Showing first 2 matched files of 595 total files |
|
|
0/1 |
114.5 GB |
||
|
|
204.5 MB |
|
|
204.5 MB |
|
|
182.6 MB |
|
|
3.2 KB |
|
|
94.4 MB |
|
Showing first 5 matched files of 1261 total files |
|
|
|
15.5 MB |
||
|
|
155.8 KB |
|
Showing first 1 matched files of 73 total files |
|
|
|
135.8 GB |
||
|
|
206.7 MB |
|
Showing first 1 matched files of 564 total files |
|
|
|
1.5 GB |
||
|
|
3.6 KB |
|
|
5.2 KB |
|
Showing first 2 matched files of 1956 total files |
|
|
|
33.8 GB |
||
|
/SpacePrototype/Content/UnleashedPrototype/FMOD/Desktop/z_Deprecated.bank |
4.2 MB |
|
Showing first 1 matched files of 588 total files |
|
|
|
5.3 GB |
||
|
/04 Domain 3 Processing/076 Note Amazon Machine Learning Service is now deprecated.html |
1.4 KB |
|
Showing first 1 matched files of 138 total files |
|
Copyright © 2024 FileMood.com