dynamodb | 86 to 105 | Download files with FileMood

Welcome Guest
Log In
Register

Showing results 86 to 105 of about 467 for dynamodb

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]		25.4 GB	DOWNLOAD

/27. Amazon Serverless Services/20. AWS DynamoDB - Review of NoSQL and Data Types.mp4	20.2 MB
/27. Amazon Serverless Services/20. AWS DynamoDB - Review of NoSQL and Data Types.srt	11.3 KB
/27. Amazon Serverless Services/21. DynamoDB Introduction.mp4	32.4 MB
/27. Amazon Serverless Services/21. DynamoDB Introduction.srt	19.7 KB
/27. Amazon Serverless Services/22. DynamoDB tables, components, Primary Key.mp4	19.7 MB
Showing first 5 matched files of 1023 total files

Pragmatic System Design		569.0 MB	DOWNLOAD

/[TutsNode.com] - Pragmatic System Design/9. Design a URL Shortener (aka TinyURL)/4. DynamoDB.srt	1.3 KB
/[TutsNode.com] - Pragmatic System Design/9. Design a URL Shortener (aka TinyURL)/4. DynamoDB.mp4	2.2 MB
Showing first 2 matched files of 182 total files

20 Programming Books Collection PDF Pack 3		266.6 MB	DOWNLOAD

/Books/Alex DeBrie The DynamoDB BookGumroad 2020.pdf	21.9 MB
/Covers/Alex DeBrie The DynamoDB BookGumroad 2020.jpg	162.0 KB
Showing first 2 matched files of 40 total files

UD1		5.3 GB	DOWNLOAD

/03 Domain 2 Storage/036 DynamoDB Overview.mp4	36.7 MB
/03 Domain 2 Storage/037 DynamoDB RCU WCU.mp4	55.8 MB
/03 Domain 2 Storage/038 DynamoDB Partitions.mp4	19.9 MB
/03 Domain 2 Storage/039 DynamoDB APIs.mp4	46.2 MB
/03 Domain 2 Storage/040 DynamoDB Indexes LSI GSI.mp4	27.4 MB
Showing first 5 matched files of 138 total files

AWS Certified Cloud Practitioner - Complete NEW Course 2021		6.1 GB	DOWNLOAD

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-fr_FR.srt	8.0 KB
/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-de_DE.srt	7.9 KB
/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-id_ID.srt	7.6 KB
/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-es_ES.srt	7.4 KB
/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-it_IT.srt	7.4 KB
Showing first 5 matched files of 1644 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009		9.6 GB	DOWNLOAD

/5. Databases On AWS/5. DynamoDB.mp4	41.0 MB
/5. Databases On AWS/5. DynamoDB.srt	6.3 KB
/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].mp4	66.7 MB
/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].srt	23.0 KB
Showing first 4 matched files of 696 total files

Ignite 4.0 - Rocketseat		76.9 GB	DOWNLOAD

/Node/Chapter VI/02 - Serverless/01 - Serverless/05 - Conhecendo o DynamoDB - Rocketseat[3].mp4	43.3 MB
/Node/Chapter VI/02 - Serverless/01 - Serverless/06 - Configurando o DynamoDB - Rocketseat[3].mp4	157.8 MB
Showing first 2 matched files of 638 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!		10.3 GB	DOWNLOAD

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv	68.1 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv	109.9 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv	6.2 MB
Showing first 3 matched files of 234 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!		10.3 GB	DOWNLOAD

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv	68.1 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv	109.9 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv	6.2 MB
Showing first 3 matched files of 242 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata		6.7 GB	DOWNLOAD

/3. Domain 2 Storage/12. DynamoDB Overview.mp4	36.7 MB
/3. Domain 2 Storage/12. DynamoDB Overview.srt	11.0 KB
/3. Domain 2 Storage/13. DynamoDB RCU & WCU.mp4	55.8 MB
/3. Domain 2 Storage/13. DynamoDB RCU & WCU.srt	14.9 KB
/3. Domain 2 Storage/14. DynamoDB Partitions.mp4	19.9 MB
Showing first 5 matched files of 612 total files

Amazon Web Services in Action, Third Edition, Video Edition		2.0 GB	DOWNLOAD

/079. Chapter 12. Programming for the NoSQL database service DynamoDB.mp4	23.2 MB
/087. Chapter 12. DynamoDB Local.mp4	2.7 MB
/088. Chapter 12. Operating DynamoDB.mp4	5.9 MB
/091. Chapter 12. Comparing DynamoDB to RDS.mp4	6.8 MB
Showing first 4 matched files of 120 total files

[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02		4.4 GB	DOWNLOAD

/08 - Amazon DynamoDB/001 Introduction.mp4	8.7 MB
/08 - Amazon DynamoDB/001 Introduction_en.srt	2.1 KB
/08 - Amazon DynamoDB/002 Amazon DynamoDB.mp4	85.7 MB
/08 - Amazon DynamoDB/002 Amazon DynamoDB_en.srt	12.3 KB
/08 - Amazon DynamoDB/003 DynamoDB Partitions and Primary Keys.mp4	15.4 MB
Showing first 5 matched files of 411 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023		14.7 GB	DOWNLOAD

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/155 - Core Components of DynamoDB English.vtt	5.9 KB
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/155 - Core Components of DynamoDB.mp4	36.2 MB
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/156 - DynamoDB Consistency Model English.vtt	7.5 KB
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/156 - DynamoDB Consistency Model.mp4	55.6 MB
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/158 - Capacity Modes in DynamoDB English.vtt	7.0 KB
Showing first 5 matched files of 437 total files

Software Architecture & Technology of Large-Scale Systems		6.2 GB	DOWNLOAD

/07 - Technology Stack/034 Amazon DynamoDB.mp4	37.5 MB
/07 - Technology Stack/034 Amazon DynamoDB_en.srt	12.2 KB
/07 - Technology Stack/035 DynamoDB architecture.mp4	49.8 MB
/07 - Technology Stack/035 DynamoDB architecture_en.srt	14.9 KB
Showing first 4 matched files of 513 total files

AWS Cloud Security Bootcamp		10.3 GB	DOWNLOAD

/[TutsNode.net] - AWS Cloud Security Bootcamp/19. DynamoDB and other Cloud Databases Part 4.mp4	644.9 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/18. DynamoDB and other Cloud Databases Part 3.mp4	443.9 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/17. DynamoDB and other Cloud Databases Part 2.mp4	317.8 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/16. DynamoDB and other Cloud Databases Part 1.mp4	190.9 MB
Showing first 4 matched files of 51 total files

[ DevCourseWeb.com ] Udemy - Building REST APIs with Serverless Framework on AWS		3.6 GB	DOWNLOAD

/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB.mp4	75.2 MB
/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB_en.vtt	7.6 KB
/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation.mp4	56.8 MB
/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation_en.vtt	6.7 KB
/~Get Your Files Here !/10 - Bonus!/002 DynamoDB Crash Course.mp4	592.9 MB
Showing first 5 matched files of 158 total files

Land of the Vikings		8.0 GB	DOWNLOAD

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-common.dll	148.0 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-event-stream.dll	25.6 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-checksums.dll	45.6 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-core.dll	1.1 MB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-dynamodb.dll	2.4 MB
Showing first 5 matched files of 60 total files

[Yan Cui] AppSync Masterclass (Premium) (2023)		7.4 GB	DOWNLOAD

/3. Chapter 2 - AWS 101/3.2. DynamoDB 101.mp4	10.5 MB
/5. Chapter 4 - Building an AppSync backend -part 1-/5.25. Use context.info to remove unnecessary DynamoDB calls.mp4	29.7 MB
Showing first 2 matched files of 202 total files

Imersão DotNet Expert - Luis Dev		88.1 GB	DOWNLOAD

/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/01 - O que é DynamoDB.mp4	10.2 MB
/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/02 - Elementos e Operações do DynamoDB.mp4	18.4 MB
/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/03 - Criando tabela e executando Query e Scan.mp4	38.4 MB
/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/04 - Tipos de Índices - GSI vs LSI.mp4	44.9 MB
Showing first 4 matched files of 1124 total files

Kingdoms Reborn		3.7 GB	DOWNLOAD

/PunCity/Binaries/Win64/aws-cpp-sdk-dynamodb.dll	1.0 MB
Showing first 1 matched files of 74 total files

«« « Back Next » »»

Copyright © 2025 FileMood.com