FileMood

Showing results 87 to 106 of about 1338 for elastica

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2020

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

AWS Certified Cloud Practitioner 2020

9.2 GB

/[TutsNode.com] - AWS Certified Cloud Practitioner 2020/02 Understanding Core AWS Services/076 AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 237 total files

VA - Direct Ministry Tracks Dance 2019 [2019][MP3@320Kbps]

883.6 MB

/18. Elastica And David Sanchez And Ivan Sanchez Presents David Sanchez And Ivan Sanchez - The Sound Of Work.mp3

16.9 MB

 

Showing first 1 matched files of 81 total files

ICE MC (1990-2004)

3.0 GB

/ICE MC - 2004 - Cold Skool (DWA, M4 02, WEB)/12 - Elastica.flac

25.7 MB

 

Showing first 1 matched files of 148 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

UD151

11.5 GB

/11 Databases/187 Amazon ElastiCache Overview.mp4

33.8 MB

/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4

36.6 MB

/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4

56.2 MB

/11 Databases/190 ElastiCache Redis AUTH.mp4

7.4 MB

/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4

61.2 MB

 

Showing first 5 matched files of 275 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.mp4

44.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.srt

21.9 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.mp4

34.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.srt

18.6 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/4. Amazon ElastiCache - Caching Strategies.mp4

12.8 MB

 

Showing first 5 matched files of 1023 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

EDC Radio Clubbing Sound

1.7 GB

/069. Elastica & Aftertouch - I'm Wild.mp3

13.4 MB

 

Showing first 1 matched files of 151 total files

Curso Stories Animados - Caio Vinicius

3.1 GB

/09 - Animação para Show e Eventos - Avançado/4 - Criando banner animado com expressão elástica (Segredo Revelado)/copie e cole.txt

0.4 KB

/09 - Animação para Show e Eventos - Avançado/4 - Criando banner animado com expressão elástica (Segredo Revelado)/Hotmart Club - 3 - Criando banner animado com expressão elástica (Segredo Revelado).MP4

68.2 MB

/09 - Animação para Show e Eventos - Avançado/5 - Animando imagens com expressão elástica/copie e cole.txt

0.4 KB

/09 - Animação para Show e Eventos - Avançado/5 - Animando imagens com expressão elástica/Hotmart Club - 5 - Animando imagens com expressão elástica.MP4

91.9 MB

 

Showing first 4 matched files of 139 total files

MP3-daily-2021-March-22-Hardcore

547.3 MB

/VA-Nothing_But____Hard_Dance_Selections_Vol._14-NBHDS14-WEB-2021-COS_INT/09-elastica_and_jesus_elices-tahikiry_(japan_mix_remastered).mp3

15.2 MB

 

Showing first 1 matched files of 68 total files

MP3-daily-2021-February-01-Euro-House

1.4 GB

/VA-Blanco_Y_Negro_Mix_8-MXCD_1160_CD_CTV-3CD-2001-iNViNCiBLE_iNT/307-va-elastica_presents_jesus_elices_-_maximicing_the_audience-inv.mp3

12.2 MB

 

Showing first 1 matched files of 208 total files

VA - EDC Radio Clubbing Sound (2021)

1.7 GB

/069. Elastica & Aftertouch - I'm Wild.mp3

13.4 MB

 

Showing first 1 matched files of 152 total files

Week 9 Mp3 25.04.2021 TSP RG

19.8 GB

/Mash-Up Singles Collection Part 5/Elastica vs. Mya ft. Missy Elliott - Love Is Never Here (McSleazy Bootleg) (252).mp3

8.5 MB

 

Showing first 1 matched files of 1691 total files

MutzNutz Music Pack 055 2021 - [ ANT ]

8.8 GB

/MutzNutz Music Pack 055 2021/NOW Live Forever_ The Anthems (4CD) (2021)/CD 2/12. Elastica - Connection.mp3

5.8 MB

 

Showing first 1 matched files of 922 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB

 

Showing first 1 matched files of 138 total files

AWS Certified Cloud Practitioner - Complete NEW Course 2021

6.1 GB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-fr_FR.srt

12.0 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-de_DE.srt

11.3 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-id_ID.srt

11.3 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-pt_BR.srt

11.1 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-it_IT.srt

11.1 KB

 

Showing first 5 matched files of 1644 total files

Brit Pop Essentials (2022)

532.9 MB

/15. Elastica - Line Up.mp3

8.7 MB

 

Showing first 1 matched files of 50 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB

 

Showing first 2 matched files of 696 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB

 

Showing first 2 matched files of 612 total files


Copyright © 2025 FileMood.com