FileMood

Showing results 92 to 111 of about 467 for dynamodb

UD31

7.2 GB

/03 Understanding Core AWS Services/040 Getting Started with DynamoDB.mp4

158.1 MB

 

Showing first 1 matched files of 91 total files

Pluralsight - Amazon DynamoDB Best Practices by Rajdeep Saha

414.2 MB

/1. Designing Databases with DynamoDB/0. Course Introduction.mp4

3.1 MB

/1. Designing Databases with DynamoDB/0. Course Introduction.srt

2.9 KB

/1. Designing Databases with DynamoDB/1. Intro to DynamoDB.mp4

10.2 MB

/1. Designing Databases with DynamoDB/1. Intro to DynamoDB.srt

7.7 KB

/1. Designing Databases with DynamoDB/2. DynamoDB Use Cases.mp4

12.1 MB

 

Showing first 5 matched files of 74 total files

PluralSight.Developing..NET.Core.Applications.with.DynamoDB.on.AWS.Bookware-KNiSO

340.4 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.nfo

2.0 KB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r00

15.0 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r01

15.0 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r02

15.0 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r03

15.0 MB

 

Showing first 5 matched files of 25 total files

[OTUS] AWS для разработчиков (Часть 1-3) (2020)

5.5 GB

/14 RDS, DynamoDB, Neptune/cloud_lec_RDS.pptx

413.4 KB

/14 RDS, DynamoDB, Neptune/zoom.mp4

134.3 MB

 

Showing first 2 matched files of 58 total files

UD151

11.5 GB

/10 Serverless/165 Create function to log event when records updated in DynamoDB.mp4

77.9 MB

/11 Databases/183 Amazon DynamoDB Overview.mp4

41.8 MB

/11 Databases/184 Create Amazon DynamoDB Table.mp4

36.7 MB

/11 Databases/185 Create Amazon DynamoDB DAX Cluster and Test Cache.mp4

120.3 MB

/11 Databases/186 Create Amazon DynamoDB Global Table.mp4

25.5 MB

 

Showing first 5 matched files of 275 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/27. Amazon Serverless Services/20. AWS DynamoDB - Review of NoSQL and Data Types.mp4

20.2 MB

/27. Amazon Serverless Services/20. AWS DynamoDB - Review of NoSQL and Data Types.srt

11.3 KB

/27. Amazon Serverless Services/21. DynamoDB Introduction.mp4

32.4 MB

/27. Amazon Serverless Services/21. DynamoDB Introduction.srt

19.7 KB

/27. Amazon Serverless Services/22. DynamoDB tables, components, Primary Key.mp4

19.7 MB

 

Showing first 5 matched files of 1023 total files

20 Programming Books Collection PDF Pack 3

266.6 MB

/Books/Alex DeBrie The DynamoDB BookGumroad 2020.pdf

21.9 MB

/Covers/Alex DeBrie The DynamoDB BookGumroad 2020.jpg

162.0 KB

 

Showing first 2 matched files of 40 total files

UD1

5.3 GB

/03 Domain 2 Storage/036 DynamoDB Overview.mp4

36.7 MB

/03 Domain 2 Storage/037 DynamoDB RCU WCU.mp4

55.8 MB

/03 Domain 2 Storage/038 DynamoDB Partitions.mp4

19.9 MB

/03 Domain 2 Storage/039 DynamoDB APIs.mp4

46.2 MB

/03 Domain 2 Storage/040 DynamoDB Indexes LSI GSI.mp4

27.4 MB

 

Showing first 5 matched files of 138 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/5. DynamoDB.mp4

41.0 MB

/5. Databases On AWS/5. DynamoDB.srt

6.3 KB

/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].mp4

66.7 MB

/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].srt

23.0 KB

 

Showing first 4 matched files of 696 total files

Ignite 4.0 - Rocketseat

76.9 GB

/Node/Chapter VI/02 - Serverless/01 - Serverless/05 - Conhecendo o DynamoDB - Rocketseat[3].mp4

43.3 MB

/Node/Chapter VI/02 - Serverless/01 - Serverless/06 - Configurando o DynamoDB - Rocketseat[3].mp4

157.8 MB

 

Showing first 2 matched files of 638 total files

[Tutorialsplanet.NET] Udemy - HashiCorp Certified Terraform Associate 2023

7.0 GB

/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Bulgarian.srt

13.4 KB

/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Czech.srt

8.3 KB

/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Danish.srt

8.5 KB

/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Dutch.srt

8.6 KB

/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking English.srt

9.9 KB

 

Showing first 5 matched files of 1798 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv

68.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv

109.9 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv

6.2 MB

 

Showing first 3 matched files of 234 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv

68.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv

109.9 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv

6.2 MB

 

Showing first 3 matched files of 242 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/12. DynamoDB Overview.mp4

36.7 MB

/3. Domain 2 Storage/12. DynamoDB Overview.srt

11.0 KB

/3. Domain 2 Storage/13. DynamoDB RCU & WCU.mp4

55.8 MB

/3. Domain 2 Storage/13. DynamoDB RCU & WCU.srt

14.9 KB

/3. Domain 2 Storage/14. DynamoDB Partitions.mp4

19.9 MB

 

Showing first 5 matched files of 612 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/079. Chapter 12. Programming for the NoSQL database service DynamoDB.mp4

23.2 MB

/087. Chapter 12. DynamoDB Local.mp4

2.7 MB

/088. Chapter 12. Operating DynamoDB.mp4

5.9 MB

/091. Chapter 12. Comparing DynamoDB to RDS.mp4

6.8 MB

 

Showing first 4 matched files of 120 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023

14.7 GB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/155 - Core Components of DynamoDB English.vtt

5.9 KB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/155 - Core Components of DynamoDB.mp4

36.2 MB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/156 - DynamoDB Consistency Model English.vtt

7.5 KB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/156 - DynamoDB Consistency Model.mp4

55.6 MB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/158 - Capacity Modes in DynamoDB English.vtt

7.0 KB

 

Showing first 5 matched files of 437 total files

Software Architecture & Technology of Large-Scale Systems

6.2 GB

/07 - Technology Stack/034 Amazon DynamoDB.mp4

37.5 MB

/07 - Technology Stack/034 Amazon DynamoDB_en.srt

12.2 KB

/07 - Technology Stack/035 DynamoDB architecture.mp4

49.8 MB

/07 - Technology Stack/035 DynamoDB architecture_en.srt

14.9 KB

 

Showing first 4 matched files of 513 total files

AWS Cloud Security Bootcamp

10.3 GB

/[TutsNode.net] - AWS Cloud Security Bootcamp/19. DynamoDB and other Cloud Databases Part 4.mp4

644.9 MB

/[TutsNode.net] - AWS Cloud Security Bootcamp/18. DynamoDB and other Cloud Databases Part 3.mp4

443.9 MB

/[TutsNode.net] - AWS Cloud Security Bootcamp/17. DynamoDB and other Cloud Databases Part 2.mp4

317.8 MB

/[TutsNode.net] - AWS Cloud Security Bootcamp/16. DynamoDB and other Cloud Databases Part 1.mp4

190.9 MB

 

Showing first 4 matched files of 51 total files

[ DevCourseWeb.com ] Udemy - Building REST APIs with Serverless Framework on AWS

3.6 GB

/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB.mp4

75.2 MB

/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB_en.vtt

7.6 KB

/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation.mp4

56.8 MB

/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation_en.vtt

6.7 KB

/~Get Your Files Here !/10 - Bonus!/002 DynamoDB Crash Course.mp4

592.9 MB

 

Showing first 5 matched files of 158 total files

[ DevCourseWeb.com ] Udemy - Amazon DynamoDB - Advanced Developer's Guide

2.8 GB

/~Get Your Files Here !/12. Data Resilience , Security and Encryption/3. DynamoDB VPC endpoints.mp4

45.3 MB

/~Get Your Files Here !/14. Node.js and DynamoDB/1. Creating tables in DynamoDB using Node.js.mp4

51.7 MB

/~Get Your Files Here !/14. Node.js and DynamoDB/2. Inserting data into DynamoDB using Node.js.mp4

22.2 MB

/~Get Your Files Here !/14. Node.js and DynamoDB/3. Querying data using Node.js.mp4

21.3 MB

/~Get Your Files Here !/14. Node.js and DynamoDB/4. Understanding Streams.mp4

50.9 MB

 

Showing first 5 matched files of 3303 total files


Copyright © 2025 FileMood.com