FileMood

Showing results 1300 to 1319 of about 5000 for lambda

Java.COMPLETO.2020.Programação.Orientada.a.Objetos.+Projetos

30.8 GB

20. Programação funcional e expressões lambda/1. Visão geral do capítulo Programação Funcional e Expressões Lambda.mp4

36.1 MB

20. Programação funcional e expressões lambda/2. Material de apoio do capítulo.html

0.4 KB

20. Programação funcional e expressões lambda/2.1 15-programacao-funcional-expressoes-lambda(espaco-para-anotacoes).pdf.pdf

201.5 KB

20. Programação funcional e expressões lambda/2.2 15-programacao-funcional-expressoes-lambda.pdf.pdf

204.4 KB

20. Programação funcional e expressões lambda/3. Uma experiência com Comparator.mp4

213.6 MB

 

Showing first 5 matched files of 403 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

03 - SDLC Automation (Domain 1)/009 CodeCommit - & AWS Lambda.mkv

63.7 MB

03 - SDLC Automation (Domain 1)/028 CodeDeploy - Deploy to AWS Lambda.mkv

70.7 MB

03 - SDLC Automation (Domain 1)/037 CodePipeline - Custom Action Jobs with AWS Lambda.mkv

104.1 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/026 CloudFormation - Deploying Lambda Functions.mkv

115.2 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/045 Lambda - Overview.mkv

99.4 MB

 

Showing first 5 matched files of 242 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

4. Domain 3 Processing/2. What is AWS Lambda.mp4

23.6 MB

4. Domain 3 Processing/2. What is AWS Lambda.srt

8.7 KB

4. Domain 3 Processing/3. Lambda Integration - Part 1.mp4

44.9 MB

4. Domain 3 Processing/3. Lambda Integration - Part 1.srt

9.7 KB

4. Domain 3 Processing/4. Lambda Integration - Part 2.mp4

35.3 MB

 

Showing first 5 matched files of 612 total files

TeamTreehouse - Intermediate C# (Track) [Thomas]

1.7 GB

01. Querying With LINQ/02. Functional Programming in C#/04. Lambda Expressions.webm

11.4 MB

01. Querying With LINQ/02. Functional Programming in C#/Project Files/LINQ-LambdaExpressions.zip

3.2 KB

 

Showing first 2 matched files of 110 total files

[Fanbox+Fantia] Lambda (667 pics) (2048x, q98jpeg).7z

498.0 MB

VA - Future Trance (1997-2022) MP3

53.1 GB

1999 - Future Trance Vol. 7/CD2/09. Lambda - Hold On Tight 2000 (Future Breeze Radio Mix).mp3

7.3 MB

2000 - Future Trance Vol. 11/CD2/17. Lambda - New York (Future Breeze Single Edit).mp3

8.4 MB

2003 - Future Trance Vol. 24/CD2/19. Lambda - Hold On Tight (Kaylab & Reloop Mix).mp3

8.8 MB

 

Showing first 3 matched files of 6099 total files

Beatport Synthwave Sound Pack #558

1.7 GB

004. Apex Shift - Lambda.mp3

5.8 MB

 

Showing first 1 matched files of 132 total files

[ FreeCourseWeb.com ] Udemy - AWS DevOps - Build dynamic Website using S3,Lambda and CDN

677.4 MB

~Get Your Files Here !/1. Introduction and Concepts/3. What is Serverless and Lambda.mp4

35.4 MB

~Get Your Files Here !/1. Introduction and Concepts/3. What is Serverless and Lambda.srt

7.6 KB

~Get Your Files Here !/2. Lab Activity/4. Creation of a Lambda Function and Hosting a Dynamic Website.mp4

157.3 MB

~Get Your Files Here !/2. Lab Activity/4. Creation of a Lambda Function and Hosting a Dynamic Website.srt

19.1 KB

 

Showing first 4 matched files of 20 total files

[Fanbox] lambda(jpg+gif) (1300 pics).zip

5.6 GB

VA-Pure Progressive Vol. 3 (EXTENDED) (mixed by Slam Duck)-(BHCD239E)-WEB-2023

376.0 MB

20. Kay-D - Lambda Code 11 (Extended Mix).mp3

17.5 MB

 

Showing first 1 matched files of 23 total files

Pluralsight - Java SE 17 Path

7.5 GB

Java SE 17 Advanced Language Features/6. Lambda Expressions and Method References/1. Quick Review of Lambda Expressions.mp4

11.3 MB

Java SE 17 Advanced Language Features/6. Lambda Expressions and Method References/1. Quick Review of Lambda Expressions.srt

9.1 KB

Java SE 17 Advanced Language Features/6. Lambda Expressions and Method References/2. Functional Interfaces.mp4

13.5 MB

Java SE 17 Advanced Language Features/6. Lambda Expressions and Method References/2. Functional Interfaces.srt

6.6 KB

Java SE 17 Advanced Language Features/6. Lambda Expressions and Method References/3. Standard Functional Interfaces.mp4

6.9 MB

 

Showing first 5 matched files of 1936 total files

[OTUS] C++ Developer. Professional (2023)

13.2 GB

02. Особенности Cpp11. auto, lambda, tuple_/02. homework.pdf

613.0 KB

02. Особенности Cpp11. auto, lambda, tuple_/02. homework.zip

7.7 KB

02. Особенности Cpp11. auto, lambda, tuple_/02. Особенности Cpp11. auto, lambda, tuple .mp4

299.6 MB

02. Особенности Cpp11. auto, lambda, tuple_/links.txt

0.3 KB

02. Особенности Cpp11. auto, lambda, tuple_/source.zip

3.7 KB

 

Showing first 5 matched files of 181 total files

REST APIs with Flask and Python in 2023

2.2 GB

Chapter 02 A Full Python Refresher/024. Lambda Functions in Python en.srt

14.8 KB

Chapter 02 A Full Python Refresher/024. Lambda Functions in Python.mp4

17.9 MB

 

Showing first 2 matched files of 1656 total files

[FreeCourseSite.com] Udemy - Android 12 Jetpack Compose Developer Course - From 0 To Hero

7.1 GB

5. More Fundamentals of Kotlin/9. Lambda Expressions.mp4

18.5 MB

5. More Fundamentals of Kotlin/9. Lambda Expressions.srt

6.9 KB

 

Showing first 2 matched files of 223 total files

[ CoursePig.com ] Udemy - Algorithmic Trading with Python - Technical Analysis Strategy (Updated 10 - 2021)

2.5 GB

~Get Your Files Here !/2. Chapter 1 Basics of Python/14. Functions Lambda function.mp4

15.5 MB

~Get Your Files Here !/2. Chapter 1 Basics of Python/14. Functions Lambda function.srt

1.4 KB

 

Showing first 2 matched files of 143 total files

[ DevCourseWeb.com ] AWS for Beginners - Start Your Amazon Cloud Computing Journey

3.2 GB

~Get Your Files Here !/10. Serverless Computing (Lambda Functions) and AWS API Gateway/1. AWS Lambda Functions - Overview.mp4

17.8 MB

~Get Your Files Here !/10. Serverless Computing (Lambda Functions) and AWS API Gateway/2. [Hands-on] Launch First Lambda Function.mp4

57.8 MB

~Get Your Files Here !/10. Serverless Computing (Lambda Functions) and AWS API Gateway/3. [Hands-on] S3 Trigger Lambda Function to Write to DynamoDB Table.mp4

126.9 MB

~Get Your Files Here !/10. Serverless Computing (Lambda Functions) and AWS API Gateway/4. AWS API Gateway - Overview.mp4

28.7 MB

~Get Your Files Here !/10. Serverless Computing (Lambda Functions) and AWS API Gateway/5. [Hands-on] Create a Quote REST API with Lambda Proxy Integration.mp4

98.4 MB

 

Showing first 5 matched files of 237 total files

[ TutGator.com ] Udemy - Python for Algorithmic trading - Technical analysis strategy

1.6 GB

~Get Your Files Here !/2. Basics of Python/14. Functions Lambda function.mp4

15.5 MB

~Get Your Files Here !/2. Basics of Python/14. Functions Lambda function.srt

1.4 KB

 

Showing first 2 matched files of 116 total files

[FreeCourseSite.com] Udemy - 2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT

20.6 GB

38 - Day 29 Lambda Functions Using AWS Console/0. Websites you may like/[CourseClub.Me].url

0.1 KB

38 - Day 29 Lambda Functions Using AWS Console/0. Websites you may like/[FreeCourseSite.com].url

0.1 KB

38 - Day 29 Lambda Functions Using AWS Console/0. Websites you may like/[GigaCourse.Com].url

0.0 KB

38 - Day 29 Lambda Functions Using AWS Console/001 Day Welcome Message.mp4

5.3 MB

38 - Day 29 Lambda Functions Using AWS Console/001 Day Welcome Message_en.srt

1.2 KB

 

Showing first 5 matched files of 969 total files

Alishev

39.2 GB

04_Продвинутая Java/05 Лямбда - выражения Lambda expressions/033 Лямбда - выражения часть I.mp4

73.0 MB

04_Продвинутая Java/05 Лямбда - выражения Lambda expressions/034 Лямбда - выражения часть II.mp4

77.3 MB

 

Showing first 2 matched files of 833 total files

[FreeCoursesOnline.Me] A Cloud Guru - Running Linux Servers on AWS

1.5 GB

03 Managing Linux EC2 Instances on AWS/011 What Is AWS Lambda.html

22.9 KB

 

Showing first 1 matched files of 59 total files


Copyright © 2026 FileMood.com