processing | 2240 to 2259 | Download files with FileMood

Welcome Guest
Log In
Register

Showing results 2240 to 2259 of about 5000 for processing

The Library Of Babel		1.5 GB	DOWNLOAD

/The Library of Babel_Data/Managed/Unity.Postprocessing.Runtime.dll	148.0 KB
Showing first 1 matched files of 340 total files

Gunsmith.Simulator.v0.19.14		13.2 GB	DOWNLOAD

/Gunsmith.Simulator.v0.19.14/game/Gunsmith Simulator_Data/Managed/Unity.Postprocessing.Runtime.dll	147.5 KB
Showing first 1 matched files of 184 total files

[ CourseWikia.com ] Artificial Intelligence and ChatGPT for Beginners		1.4 GB	DOWNLOAD

/~Get Your Files Here !/3. Natural Language Processing (NLP)/1. Natural Language Processing (NLP).mp4	175.4 MB
Showing first 1 matched files of 8 total files

HitPaw Photo Enhancer 2.2.3.2 Portable by Жека		1.4 GB	DOWNLOAD

/App/PhotoEnhancer/PublicPlugin/ProcessingproxyPlugin.dll	145.8 KB
Showing first 1 matched files of 1261 total files

Craftopia		23.1 GB	DOWNLOAD

/Craftopia_Data/Managed/Unity.Postprocessing.Runtime.dll	149.5 KB
Showing first 1 matched files of 2001 total files

[ DevCourseWeb.com ] Udemy - Machine Learning In Healthcare - Practical Approach By Orange		922.8 MB	DOWNLOAD

/~Get Your Files Here !/3 - Project 1 Diabetes Prediction using Machine Learning/8 - Data Preprocessing Gain Ratio.mp4	54.7 MB
Showing first 1 matched files of 15 total files

[ FreeCryptoLearn.com ] Udemy - Export Finance, Priority Sector, Retail Loan and Documentation		1.9 GB	DOWNLOAD

/~Get Your Files Here !/6 - Fair Practices Code on Lenders Liability/115 - Fair Practices Code for Loan Processing English.vtt	3.1 KB
/~Get Your Files Here !/6 - Fair Practices Code on Lenders Liability/115 - Fair Practices Code for Loan Processing.mp4	7.7 MB
Showing first 2 matched files of 244 total files

junos-srxsme		74.5 GB	DOWNLOAD

/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview.pdf	5.1 MB
/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_chocr.html.gz	13.9 MB
/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_djvu.txt	1.1 MB
/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_djvu.xml	13.9 MB
/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_hocr.html	27.4 MB
Showing first 5 matched files of 1818 total files

BnS		68.7 GB	DOWNLOAD

/Engine/Binaries/ThirdParty/Python3/Win64/DLLs/_multiprocessing.pyd	29.7 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/connection.py	32.1 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/context.py	11.3 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/connection.py	1.7 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/__init__.py	3.2 KB
Showing first 5 matched files of 3491 total files

Soulja - The Beginners Dropshipping Course (www.imarketing.courses)		1.2 GB	DOWNLOAD

/06-6. Payment Processing Optimization.mp4	25.7 MB
Showing first 1 matched files of 9 total files

BnS		70.7 GB	DOWNLOAD

/Engine/Binaries/ThirdParty/Python3/Win64/DLLs/_multiprocessing.pyd	29.7 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/connection.py	32.1 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/context.py	11.3 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/connection.py	1.7 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/__init__.py	3.2 KB
Showing first 5 matched files of 3519 total files

[ CourseBoat.com ] Udemy - Basics of Computer Science and Information Systems (BCSIS)		1.1 GB	DOWNLOAD

/~Get Your Files Here !/4. Module 3 - Types of Information Systems (IS) and Application/3. BCSIS-Module3-V1-Types-of-InformationSystems-P3-TransactionProcessingSys-OfficeA.mp4	69.8 MB
/~Get Your Files Here !/4. Module 3 - Types of Information Systems (IS) and Application/3. BCSIS-Module3-V1-Types-of-InformationSystems-P3-TransactionProcessingSys-OfficeA.srt	7.3 KB
Showing first 2 matched files of 46 total files

Hardspace Shipbreaker (2022)		4.0 GB	DOWNLOAD

/Hardspace Shipbreaker/Shipbreaker_Data/Managed/Unity.Postprocessing.Runtime.dll	149.0 KB
/Hardspace Shipbreaker/Shipbreaker_Data/StreamingAssets/aa/StandaloneWindows64/rendering-postprocessing_assets_all_1e7bb33e54290d37d5b99b7853acce46.bundle	34.7 KB
Showing first 2 matched files of 753 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata		6.7 GB	DOWNLOAD

/4. Domain 3 Processing/1. Section Introduction Processing.mp4	32.2 MB
/4. Domain 3 Processing/1. Section Introduction Processing.srt	2.3 KB
/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.mp4	44.3 MB
/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.srt	44.3 MB
/4. Domain 3 Processing/11. Glue Costs and Anti-Patterns.mp4	15.4 MB
Showing first 5 matched files of 612 total files

usenet-sci		23.4 GB	DOWNLOAD

/sci.image.processing.mbox.zip	54.3 MB
Showing first 1 matched files of 482 total files

Stranded Deep		4.2 GB	DOWNLOAD

/Stranded_Deep_Data/Managed/Unity.Postprocessing.Runtime.dll	144.9 KB
Showing first 1 matched files of 232 total files

starboundsourcecode		791.6 MB	DOWNLOAD

/source/core/StarImageProcessing.cpp	22.2 KB
/source/core/StarImageProcessing.hpp	4.0 KB
Showing first 2 matched files of 635 total files

Risk of Rain 2		2.3 GB	DOWNLOAD

/Risk of Rain 2_Data/Managed/Unity.Postprocessing.Runtime.dll	147.5 KB
Showing first 1 matched files of 1838 total files

[ FreeCourseWeb.com ] Rabelway - Introduction to Houdini for FX (Week 2)		1.9 GB	DOWNLOAD

/~Get Your Files Here !/22_post_processing.mp4	182.9 MB
Showing first 1 matched files of 26 total files

Stranded Deep (2022)		2.3 GB	DOWNLOAD

/Stranded Deep/Stranded_Deep_Data/Managed/Unity.Postprocessing.Runtime.dll	144.9 KB
Showing first 1 matched files of 215 total files

«« « Back Next » »»

Copyright © 2025 FileMood.com