FileMood

Showing results 2880 to 2899 of about 5000 for components

Udemy - Mastering Maintainable React

5.4 GB

/48. Refactoring - Extract sub-components.mp4

144.6 MB

/52. Refactoring - Reduce duplication and extract more sub-components.mp4

224.0 MB

 

Showing first 2 matched files of 50 total files

Adobe.After.Effects.2023.v23.5.0.52.Multilingual.Incl.Patch-x64

2.8 GB

/Setup/products/CCXP/CCXProcess-Components.zip

38.1 KB

 

Showing first 1 matched files of 214 total files

Craftopia

23.1 GB

/Craftopia_Data/Managed/Mirror.Components.dll

110.1 KB

/Craftopia_Data/Managed/NavMeshComponents.dll

16.9 KB

 

Showing first 2 matched files of 2001 total files

Adobe Premiere Pro 2023 v23.6.0.65 x64 Multilingual

9.7 GB

/products/CCXP/CCXProcess-Components.zip

38.1 KB

 

Showing first 1 matched files of 63 total files

Adobe After Effects 2023 v23.6.0.62 (x64) Multilingual

2.8 GB

/products/CCXP/CCXProcess-Components.zip

38.1 KB

 

Showing first 1 matched files of 218 total files

[FreeCourseSite.com] Udemy - ASP.NET Core Razor Pages The Complete Guide (.NET 6)

7.2 GB

/13 - Advanced Topics/002 View Components.mp4

68.5 MB

/13 - Advanced Topics/002 View Components_en.srt

13.6 KB

 

Showing first 2 matched files of 641 total files

Social Video Downloader 6.19.0 (x32x64) portable

106.2 MB

/App/SocialVideoDownloader/Components/avcodec-59.dll

41.9 MB

/App/SocialVideoDownloader/Components/avdevice-59.dll

2.2 MB

/App/SocialVideoDownloader/Components/avfilter-8.dll

6.9 MB

/App/SocialVideoDownloader/Components/avformat-59.dll

14.0 MB

/App/SocialVideoDownloader/Components/avutil-57.dll

674.8 KB

 

Showing first 5 matched files of 39 total files

[ CourseBoat.com ] Udemy - Basics of Computer Science and Information Systems (BCSIS)

1.1 GB

/~Get Your Files Here !/3. Module 2 - Introduction to Information and Information Systems/3. BCSIS-Module2-V1-Introdcution-Information-InformationSystems-P3-Components-AeasJ.mp4

26.8 MB

/~Get Your Files Here !/3. Module 2 - Introduction to Information and Information Systems/3. BCSIS-Module2-V1-Introdcution-Information-InformationSystems-P3-Components-AeasJ.srt

5.2 KB

 

Showing first 2 matched files of 46 total files

Adobe After Effects 2023 23.5.0.52 (x64) Multilingual

2.8 GB

/Setup/products/CCXP/CCXProcess-Components.zip

38.1 KB

 

Showing first 1 matched files of 214 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/2. Domain 1 Collection/17. IoT Components Deep Dive.mp4

42.2 MB

/2. Domain 1 Collection/17. IoT Components Deep Dive.srt

12.1 KB

 

Showing first 2 matched files of 612 total files

usenet-sci

23.4 GB

/sci.electronics.components.mbox.zip

80.7 MB

 

Showing first 1 matched files of 482 total files

Adobe Substance 3D Sampler v4.1.2.3298 (x64) + Fix {CracksHash}

1.9 GB

/Setup/products/SBSTA/Substance3DSampler1-core/1/Adobe Substance 3D Sampler/include/igl/connected_components.cpp

0.9 KB

/Setup/products/SBSTA/Substance3DSampler1-core/1/Adobe Substance 3D Sampler/include/igl/connected_components.h

0.7 KB

/Setup/products/SBSTA/Substance3DSampler1-core/1/Adobe Substance 3D Sampler/include/igl/facet_components.cpp

1.3 KB

/Setup/products/SBSTA/Substance3DSampler1-core/1/Adobe Substance 3D Sampler/include/igl/facet_components.h

0.7 KB

/Setup/products/SBSTA/Substance3DSampler1-core/1/Adobe Substance 3D Sampler/include/igl/vertex_components.cpp

1.2 KB

 

Showing first 5 matched files of 4936 total files

Ryan Hayward (Flux Academy) - Framer Masterclass (www.imarketing.courses)

3.6 GB

/03-Components/01-Framer Remix (Components).pdf

23.4 KB

/03-Components/01-Overview of Components.mp4

26.3 MB

/03-Components/02-Variables.mp4

21.0 MB

/03-Components/03-Variants.mp4

20.2 MB

/03-Components/04-Hover and Pressed States.mp4

16.5 MB

 

Showing first 5 matched files of 102 total files

[CourseClub.Me] CBTNuggets - Intermediate Angular Tutorial Working with Angular Forms

1.9 GB

/5. Reusable Forms Deep-Dive Work with Different Form Inputs/4. Create Password and Number Input Components .mp4

52.0 MB

 

Showing first 1 matched files of 42 total files

Retouch4me Components

664.5 MB

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.5 GB

/content/content0/scripts/engine/components.ws

33.7 KB

/content/content0/scripts/game/components/boatBodyComponent.ws

1.4 KB

/content/content0/scripts/game/components/craftsmanComponent.ws

11.3 KB

/content/content0/scripts/game/components/creatureDataComponent.ws

4.5 KB

/content/content0/scripts/game/components/effectComponent.ws

1.0 KB

 

Showing first 5 matched files of 2961 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.5 GB

/content/content0/scripts/engine/components.ws

33.7 KB

/content/content0/scripts/game/components/boatBodyComponent.ws

1.4 KB

/content/content0/scripts/game/components/craftsmanComponent.ws

11.3 KB

/content/content0/scripts/game/components/creatureDataComponent.ws

4.5 KB

/content/content0/scripts/game/components/effectComponent.ws

1.0 KB

 

Showing first 5 matched files of 2961 total files

TypeScript and Vue 3

1.7 GB

/2. TS Fundamentals & Options API/3. Using Types in Multiple Components.mp4

74.1 MB

 

Showing first 1 matched files of 30 total files

2203 LTSR

20.6 GB

/Components/Citrix_Virtual_Apps_and_Desktops_7_2203_Premium_Components.iso

834.5 MB

/Components/Workspace-Environment-Management-v-2203-01-00-01.zip

164.6 MB

/Components/Contextual App Protection Policies 2203/FeatureTable.OnPrem.AppProtContextualAccess.xml

6.5 KB

/Components/Session Recording 2204/SessionRecording2204.zip

200.1 MB

/CU1/Components that are in the ISO but also available separately/Citrix_Licensing_11.17.2.0_BUILD_39000.zip

57.7 MB

 

Showing first 5 matched files of 70 total files

VCpp2022_5

4.6 GB

/Installer/Win10SDK_10.0.19041,version=10.0.19041.3/Installers/Windows App Certification Kit Native Components-x64_en-us.msi

446.5 KB

/Installer/Win10SDK_10.0.19041,version=10.0.19041.3/Installers/Windows App Certification Kit Native Components-x86_en-us.msi

446.5 KB

 

Showing first 2 matched files of 1211 total files


Copyright © 2025 FileMood.com