FileMood

Showing results 3040 to 3059 of about 5000 for lecture

All TTC (The Teaching Company) Lectures Addendum Four

38.2 GB

/Dutch Masters_ The Age of Rembrandt (Video)/Dutch Masters Lecture 01.avi

299.6 MB

/Dutch Masters_ The Age of Rembrandt (Video)/Dutch Masters Lecture 02.avi

299.5 MB

/Dutch Masters_ The Age of Rembrandt (Video)/Dutch Masters Lecture 03.avi

299.6 MB

/Dutch Masters_ The Age of Rembrandt (Video)/Dutch Masters Lecture 04.avi

299.6 MB

/Dutch Masters_ The Age of Rembrandt (Video)/Dutch Masters Lecture 05.avi

284.5 MB

 

Showing first 5 matched files of 534 total files

[GigaCourse.Com] Udemy - The JavaScript Bible - JavaScript Bootcamp

16.1 GB

/02 - EXERCISE Files and SOFTWARE Setup/002 LECTURE - Software Setup Overview.mp4

38.6 MB

/02 - EXERCISE Files and SOFTWARE Setup/002 LECTURE - Software Setup Overview_en.srt

4.6 KB

/04 - JAVASCRIPT BASICS - Types and Variables/002 LECTURE - Object in JavaScript.mp4

53.7 MB

/04 - JAVASCRIPT BASICS - Types and Variables/002 LECTURE - Object in JavaScript_en.srt

4.6 KB

/04 - JAVASCRIPT BASICS - Types and Variables/003 LECTURE - Primitive vs Reference Value Types.mp4

178.0 MB

 

Showing first 5 matched files of 799 total files

[FreeCourseSite.com] Udemy - Angular Security Masterclass (with FREE E-Book)

2.4 GB

/10 - Conclusion/002 Bonus Lecture.html

5.1 KB

 

Showing first 1 matched files of 152 total files

Sanket Singh - Learn Backend In NodeJS From Scratch

19.3 GB

/0. Guest Lectures/Brewing Code With Siddharth (Jan 08, 2023).mp4

401.9 MB

/0. Guest Lectures/Making Kickass Resume.mp4

554.5 MB

 

Showing first 2 matched files of 98 total files

cseweb.ucsd.edu

5.0 GB

/~dakane/CSE101/CSE 101 Lecture 10 (127921).mp4

179.2 MB

/~dakane/CSE101/CSE 101 Lecture 11 (2121).mp4

193.8 MB

/~dakane/CSE101/CSE 101 Lecture 12 (2221).mp4

179.5 MB

/~dakane/CSE101/CSE 101 Lecture 13 (2521).mp4

180.7 MB

/~dakane/CSE101/CSE 101 Lecture 14 (2821).mp4

199.6 MB

 

Showing first 5 matched files of 254 total files

[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass

6.3 GB

/10 - Object Oriented Python/341 - lecture116challengetxt.txt

0.1 KB

/10 - Object Oriented Python/348 - lecture123challengetxt.txt

0.1 KB

/16 - ARCHIVEDProgram Flow Control in Python/489 - lecture30challengetxt.txt

0.1 KB

/16 - ARCHIVEDProgram Flow Control in Python/497 - lecture38challengetxt.txt

0.1 KB

/17 - ARCHIVEDLists Ranges & Tuples in Python/501 - lecture42challengetxt.txt

0.1 KB

 

Showing first 5 matched files of 8394 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/002 CloudFormation_ Lectures.html

0.4 KB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/022 === CloudFormation Lectures from DevOps course ===.html

0.1 KB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/059 === ECS Lectures from Certified Developer Course ===.html

0.3 KB

/08 - Course Wrap-up/006 Bonus Lecture_ Practice Exam & Special discounts for our other courses.html

7.1 KB

 

Showing first 4 matched files of 234 total files

[ CoursePig.com ] Udemy - Recruitment Interviewing Essentials - Interviewing Made Easy

1.6 GB

/~Get Your Files Here !/15 - Bonus Offers and resources/46 - Bonus Lecture.html

2.4 KB

 

Showing first 1 matched files of 124 total files

[ DevCourseWeb.com ] Udemy - System Design Essentials - Server Design Fundamental Overview

307.6 MB

/~Get Your Files Here !/3. Tools To measure performance and profile servers/1. Demo C++ code used in the following lectures to genreate measurements.mp4

15.2 MB

/~Get Your Files Here !/3. Tools To measure performance and profile servers/1. Demo C++ code used in the following lectures to genreate measurements.srt

4.2 KB

/~Get Your Files Here !/4. Conclusion/1. [Bonus lecture].html

0.1 KB

 

Showing first 3 matched files of 66 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/002 CloudFormation_ Lectures.html

0.4 KB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/022 === CloudFormation Lectures from DevOps course ===.html

0.1 KB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/059 === ECS Lectures from Certified Developer Course ===.html

0.3 KB

/08 - Course Wrap-up/006 Bonus Lecture_ Practice Exam & Special discounts for our other courses.html

7.1 KB

 

Showing first 4 matched files of 242 total files

[Tutorialsplanet.NET] Udemy - Microsoft Power BI - The Practical Guide [2022 EDITION]

12.2 GB

/15 [OLD COURSE] Working in the Query Editor/010 [Please Read]_ Important Hint for the Next Lecture.html

1.8 KB

 

Showing first 1 matched files of 687 total files

Melon Player4

142.2 MB

/html/popupPaymentTabLectureDCF.html

20.6 KB

/html/popupPaymentTabLectureFREE.html

9.9 KB

/html/popupPaymentTabLectureMP3.html

17.4 KB

/html/tabContentsInfoLecture.html

4.6 KB

 

Showing first 4 matched files of 529 total files

nand2tetris

1.1 GB

/lectures/chapter 1 lecture.pdf

11.5 MB

/lectures/chapter 1 lecture_chocr.html.gz

430.7 KB

/lectures/chapter 1 lecture_djvu.txt

30.6 KB

/lectures/chapter 1 lecture_djvu.xml

495.9 KB

/lectures/chapter 1 lecture_hocr.html

1.1 MB

 

Showing first 5 matched files of 745 total files

[ FreeCryptoLearn.com ] Udemy - Export Finance, Priority Sector, Retail Loan and Documentation

1.9 GB

/~Get Your Files Here !/7 - Last Section/121 - Bonus Lecture.html

0.1 KB

/~Get Your Files Here !/7 - Last Section/121 - BonusLecture.pdf

239.1 KB

 

Showing first 2 matched files of 244 total files

[Metart] August 2023 SiteRip 2160p

28.0 GB

/_Screens/metart.23.08.13.krystal.kitten.ginger.lecture.4k_s.jpg

865.9 KB

/metart.23.08.13.krystal.kitten.ginger.lecture.4k.mp4

2.6 GB

 

Showing first 2 matched files of 18 total files

free-course-site.com-udemy-java-for-complete-beginners

510.7 MB

/9. Bonus/1. Bonus Lecture Algorithms and Data Structures in Java.html

0.8 KB

 

Showing first 1 matched files of 106 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/12. Wrapping Up/3. Bonus Lecture Special discounts for our other courses.html

11.3 KB

 

Showing first 1 matched files of 612 total files

podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855

74.1 MB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855.mp3

73.9 MB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_itemimage.png

132.7 KB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_itunes.json

1.8 KB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_meta.sqlite

21.5 KB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_meta.xml

2.3 KB

 

Showing first 5 matched files of 6 total files

ManlyP.Hall-CompleteLectureSeries-Part2

56.4 MB

/ManlyP.Hall-CompleteLectureSeries-Part2_meta.xml

0.9 KB

 

Showing first 1 matched files of 12 total files

podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250

14.9 MB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250.m4a

12.8 MB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_itemimage.png

2.0 MB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_itunes.json

1.2 KB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_meta.sqlite

16.4 KB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_meta.xml

1.6 KB

 

Showing first 5 matched files of 6 total files


Copyright © 2025 FileMood.com