FileMood

Showing results 3100 to 3119 of about 5000 for functions

free-course-site.com-udemy-java-for-complete-beginners

510.7 MB

/6. Functions/1. What is function .mp4

8.9 MB

/6. Functions/1. What is function .vtt

1.5 KB

/6. Functions/2. CODE Functions.mp4

9.5 MB

/6. Functions/2. CODE Functions.vtt

5.3 KB

/6. Functions/2.1 Functions.zip.zip

15.4 KB

 

Showing first 5 matched files of 106 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/4. Domain 3 Processing/30. AWS Step Functions.mp4

20.2 MB

/4. Domain 3 Processing/30. AWS Step Functions.srt

7.2 KB

 

Showing first 2 matched files of 612 total files

udemy-course-downloader-arduino-programming-and-hardware-fundamentals-with-hackster

1.6 GB

/02. Programming Basics/13. Writing Functions.mp4

19.2 MB

 

Showing first 1 matched files of 181 total files

Ultimate ASP.NET Core 3 Web API (2021) [En]

625.9 MB

/First edition/All Materials in .NET 5/Bonus 6 - Security/01-Setting up IS4 and UI/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/03-Securing the Web Application/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/04-Authorization and Working with Claims/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/05-Securing Web API/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/06-Expiration and Reference tokens/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

 

Showing first 5 matched files of 19018 total files

Drake Surach - ChatGTP Mastery Course (www.imarketing.courses)

7.6 GB

/02-Beginner's Prompting/04-System functions.mp4

460.8 MB

/02-Beginner's Prompting/04-System functions.png

202.6 KB

/02-Beginner's Prompting/04-System functions.rtf

42.9 KB

 

Showing first 3 matched files of 86 total files

Stranded Deep

4.2 GB

/Stranded_Deep_Data/Managed/Rewired_Windows_Functions.dll

4.1 KB

 

Showing first 1 matched files of 232 total files

render.camp - PV 9.0

74.9 GB

/03. Technical Basics/RMB Functions.mp4

11.9 MB

 

Showing first 1 matched files of 164 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.5 GB

/content/content0/scripts/game/quests/functions/bossFights.ws

11.6 KB

/content/content0/scripts/game/quests/functions/tutorial.ws

56.3 KB

/content/content0/scripts/game/scenes/scene_functions.ws

58.3 KB

 

Showing first 3 matched files of 2961 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.5 GB

/content/content0/scripts/game/quests/functions/bossFights.ws

11.6 KB

/content/content0/scripts/game/quests/functions/tutorial.ws

56.3 KB

/content/content0/scripts/game/scenes/scene_functions.ws

58.3 KB

 

Showing first 3 matched files of 2961 total files

Stranded Deep (2022)

2.3 GB

/Stranded Deep/Stranded_Deep_Data/Managed/Rewired_Windows_Functions.dll

4.1 KB

 

Showing first 1 matched files of 215 total files

[Skillshare] Unreal Engine 5 Blueprints for Beginners [ENG-RUS]

4.9 GB

/19 What are Events, Functions & Macros.mkv

28.2 MB

/21 Functions.mkv

45.6 MB

/27 Array Functions.mkv

27.5 MB

/28 What are Execution Flow Functions.mkv

21.3 MB

 

Showing first 4 matched files of 71 total files

Terraform

2.3 GB

/1. Terraform - Getting Started/07-17 - Using Functions and Looping in Your Configuration -- Summary.mp4

778.1 KB

/1. Terraform - Getting Started/07-01 - Using Functions and Looping in Your Configuration -- Overview.mp4

1.6 MB

/1. Terraform - Getting Started/07-06 - Using Functions and Looping in Your Configuration -- Looping Targets.mp4

1.9 MB

/1. Terraform - Getting Started/07-02 - Using Functions and Looping in Your Configuration -- Globomantics Updates.mp4

2.1 MB

/1. Terraform - Getting Started/07-03 - Using Functions and Looping in Your Configuration -- Loops in Terraform.mp4

2.4 MB

 

Showing first 5 matched files of 318 total files

GetFreeCourses.Co-Udemy-SQL - The Complete Developer's Guide (MySQL, PostgreSQL)

8.7 GB

/08 - Grouping & Aggregate Functions/001 Module Introduction.mp4

6.8 MB

/08 - Grouping & Aggregate Functions/001 Module Introduction_en.srt

2.2 KB

/08 - Grouping & Aggregate Functions/002 The Module Project.mp4

21.6 MB

/08 - Grouping & Aggregate Functions/002 The Module Project_en.srt

7.0 KB

/08 - Grouping & Aggregate Functions/003 What are Aggregate Functions - Theory.mp4

24.3 MB

 

Showing first 5 matched files of 439 total files

[ FreeCourseWeb.com ] Udemy - Mr. Sutton Presents... Algebra 2 Honors

3.2 GB

/~Get Your Files Here !/1 - Introduction/1 - 11 Domain Range and Functions.mp4

118.6 MB

/~Get Your Files Here !/1 - Introduction/2 - 12 Operations and Composition of Functions.mp4

64.9 MB

/~Get Your Files Here !/1 - Introduction/3 - 13 Piecewise Functions.mp4

60.2 MB

/~Get Your Files Here !/1 - Introduction/4 - 14 Inverse Functions.mp4

83.5 MB

/~Get Your Files Here !/6 - Rational Functions/34 - 61 Shared Folder.txt

0.1 KB

 

Showing first 5 matched files of 120 total files

[ DevCourseWeb.com ] Python Fundamentals by Emmanuel A

2.7 GB

/~Get Your Files Here !/12. Collections/3. Other list functions.mp4

75.9 MB

 

Showing first 1 matched files of 44 total files

Python Project Building Online Banking App

1.5 GB

/[TutsNode.net] - Python Project Building Online Banking App/3. Basic Python Warm Up Session/6.1 Functions and Parameters Practice.py

0.6 KB

/[TutsNode.net] - Python Project Building Online Banking App/3. Basic Python Warm Up Session/6. Functions and Parameters.mp4

54.3 MB

 

Showing first 2 matched files of 75 total files

Conan Exiles [U53-471559-36636] (AoS-320)

97.0 GB

/Engine/Content/Paks/Functions.pak

1.0 MB

/Engine/Content/Paks/Functions.sig

0.1 KB

 

Showing first 2 matched files of 693 total files

Bacciotti A. Liapunov Functions and Stability in Control Theory 2ed 2005

17.9 MB

/Bacciotti A. Liapunov Functions and Stability in Control Theory 2ed 2005.pdf

17.9 MB

 

1 matched files

[ CourseWikia.com ] SQL Server - Reporting Services

547.7 MB

/~Get Your Files Here !/04 - 3. Work with Data/06 - Use aggregate functions.mp4

17.6 MB

/~Get Your Files Here !/04 - 3. Work with Data/06 - Use aggregate functions.srt

15.7 KB

 

Showing first 2 matched files of 128 total files

Tron v12.0.6 (2023-10-17)

694.3 MB

/resources/functions/initialize_environment.bat

6.2 KB

/resources/functions/log.bat

0.2 KB

/resources/functions/log_with_date.bat

0.3 KB

/resources/functions/prerun_checks_and_tasks.bat

7.2 KB

/resources/functions/tron_settings.bat

7.6 KB

 

Showing first 5 matched files of 1648 total files


Copyright © 2025 FileMood.com