FileMood

Showing results 3120 to 3139 of about 5000 for functions

Thronefall Early Access v.84.54

451.5 MB

/Thronefall.Early.Access/Thronefall.Early.Access/Thronefall_Data/Managed/Rewired_Windows_Functions.dll

5.1 KB

 

Showing first 1 matched files of 219 total files

ArmA 3 (2013)

140.5 GB

/Arma 3/Addons/functions_f.pbo

6.0 MB

/Arma 3/Addons/functions_f.pbo.a3.bisign

0.6 KB

/Arma 3/Addons/functions_f_bootcamp.pbo

743.0 KB

/Arma 3/Addons/functions_f_bootcamp.pbo.a3.bisign

0.6 KB

/Arma 3/Addons/functions_f_epa.pbo

41.9 KB

 

Showing first 5 matched files of 2493 total files

新しいフォルダー (3)

39.6 GB

/IllusionFixes_Koikatsu_15.3.1/BepInEx/plugins/IllusionFixes/KK_Fix_RestoreMissingFunctions.dll

55.8 KB

 

Showing first 1 matched files of 755 total files

Build an AutoGPT Code Writing AI Tool With Rust and GPT-4

8.8 GB

/8. Auto GPT Project - Supporting Functions/1. Supporting Functions - Section Introduction.mp4

21.0 MB

/8. Auto GPT Project - Supporting Functions/15. API Endpoint Valid Check Function.mp4

22.5 MB

/8. Auto GPT Project - Supporting Functions/4. Extract API Keys.mp4

25.8 MB

/8. Auto GPT Project - Supporting Functions/7. OpenAI Call - Test API Call.mp4

36.7 MB

/8. Auto GPT Project - Supporting Functions/2. Project Setup.mp4

38.0 MB

 

Showing first 5 matched files of 136 total files

[ DevCourseWeb.com ] Udemy - JDBC, DAO and SQL - Practical Crash Course - Build Database App

3.6 GB

/~Get Your Files Here !/05 - Relational Databases (Advanced)/001 Views, Triggers, Stored Procedures & Functions.mp4

228.4 MB

/~Get Your Files Here !/05 - Relational Databases (Advanced)/001 Views, Triggers, Stored Procedures & Functions_en.srt

39.9 KB

 

Showing first 2 matched files of 61 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/012 CloudFormation Intrinsic Functions.mkv

27.5 MB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/026 CloudFormation - Deploying Lambda Functions.mkv

115.2 MB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/051 Step Functions - Overview.mkv

71.2 MB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/058 API Gateway - Fronting Step Functions.mkv

68.5 MB

 

Showing first 4 matched files of 242 total files

Cisco Certified DevNet Associate DEVASC 200-901

3.3 GB

/Module 2 Python Fundamentals for DEVASC/Lesson 6 Getting Started with Python/007. 6.6 Functions en.srt

16.7 KB

/Module 2 Python Fundamentals for DEVASC/Lesson 6 Getting Started with Python/007. 6.6 Functions.mp4

20.9 MB

/Module 5 Network Fundamentals/Lesson 20 Common Networking Elements/002. 20.1 Network Device Functions en.srt

3.5 KB

/Module 5 Network Fundamentals/Lesson 20 Common Networking Elements/002. 20.1 Network Device Functions.mp4

6.8 MB

 

Showing first 4 matched files of 344 total files

[Tutorialsplanet.NET] Udemy - Microsoft Power BI - The Practical Guide [2022 EDITION]

12.2 GB

/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/021 DAX Core Functions.en.srt

6.8 KB

/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/021 DAX Core Functions.mp4

12.2 MB

/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/025 Working with IF Functions.en.srt

10.6 KB

/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/025 Working with IF Functions.mp4

26.9 MB

/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/026 Understanding Relationship Functions.en.srt

7.2 KB

 

Showing first 5 matched files of 687 total files

Microsoft-Toolkit-2.7.3

17.5 MB

/diag fix/system/Networking/UtilityFunctions.ps1

54.7 KB

 

Showing first 1 matched files of 305 total files

Daum PotPlayer 1.7.21990 + OpenCodec

96.8 MB

/daumfix/system/Networking/UtilityFunctions.ps1

54.7 KB

 

Showing first 1 matched files of 304 total files

BnS

68.7 GB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_functions.py

13.0 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_memfunctions.py

3.4 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/sqlite3/test/userfunctions.py

15.6 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/tkinter/test/test_ttk/test_functions.py

17.6 KB

 

Showing first 4 matched files of 3491 total files

BnS

70.7 GB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_functions.py

13.0 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_memfunctions.py

3.4 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/sqlite3/test/userfunctions.py

15.6 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/tkinter/test/test_ttk/test_functions.py

17.6 KB

 

Showing first 4 matched files of 3519 total files

free-course-site.com-udemy-java-for-complete-beginners

510.7 MB

/6. Functions/1. What is function .mp4

8.9 MB

/6. Functions/1. What is function .vtt

1.5 KB

/6. Functions/2. CODE Functions.mp4

9.5 MB

/6. Functions/2. CODE Functions.vtt

5.3 KB

/6. Functions/2.1 Functions.zip.zip

15.4 KB

 

Showing first 5 matched files of 106 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/4. Domain 3 Processing/30. AWS Step Functions.mp4

20.2 MB

/4. Domain 3 Processing/30. AWS Step Functions.srt

7.2 KB

 

Showing first 2 matched files of 612 total files

udemy-course-downloader-arduino-programming-and-hardware-fundamentals-with-hackster

1.6 GB

/02. Programming Basics/13. Writing Functions.mp4

19.2 MB

 

Showing first 1 matched files of 181 total files

Ultimate ASP.NET Core 3 Web API (2021) [En]

625.9 MB

/First edition/All Materials in .NET 5/Bonus 6 - Security/01-Setting up IS4 and UI/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/03-Securing the Web Application/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/04-Authorization and Working with Claims/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/05-Securing Web API/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

/First edition/All Materials in .NET 5/Bonus 6 - Security/06-Expiration and Reference tokens/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss

3.9 KB

 

Showing first 5 matched files of 19018 total files

Drake Surach - ChatGTP Mastery Course (www.imarketing.courses)

7.6 GB

/02-Beginner's Prompting/04-System functions.mp4

460.8 MB

/02-Beginner's Prompting/04-System functions.png

202.6 KB

/02-Beginner's Prompting/04-System functions.rtf

42.9 KB

 

Showing first 3 matched files of 86 total files

Stranded Deep

4.2 GB

/Stranded_Deep_Data/Managed/Rewired_Windows_Functions.dll

4.1 KB

 

Showing first 1 matched files of 232 total files

render.camp - PV 9.0

74.9 GB

/03. Technical Basics/RMB Functions.mp4

11.9 MB

 

Showing first 1 matched files of 164 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.5 GB

/content/content0/scripts/game/quests/functions/bossFights.ws

11.6 KB

/content/content0/scripts/game/quests/functions/tutorial.ws

56.3 KB

/content/content0/scripts/game/scenes/scene_functions.ws

58.3 KB

 

Showing first 3 matched files of 2961 total files


Copyright © 2025 FileMood.com