FileMood

Showing results 4120 to 4139 of about 5000 for developer

Alba A Wildlife Adventure

687.9 MB

/Alba_Data/Managed/com.unity-common.developer-panel.dll

197.1 KB

 

Showing first 1 matched files of 521 total files

sun-solaris-10-0106

21.3 GB

/sun-solaris-10-0106-developer-tools.iso

3.1 GB

/sun-solaris-10-0106-developer-tools.png

792.4 KB

/sun-solaris-10-0106-developer-tools_thumb.jpg

7.9 KB

 

Showing first 3 matched files of 54 total files

PIWIS 3 win 10 41.600+38.250developer+coding+flash

70.6 GB

[FTUApps.com] - Windows 11 Pro Ultralight Serenity 22H2 Build 22621.590 Beta Channel (x64) En-US Pre-Activated

1.6 GB

/FTUApps.com Download Cracked Developers Applications For Free.url

0.2 KB

 

Showing first 1 matched files of 6 total files

[ FreeCourseWeb.com ] Linkedin - UX DesignOps - Overview

0/1

88.5 MB

/~Get Your Files Here !/[3] 2. Working with Developers/[1] Common ground through standardization.mp4

6.2 MB

/~Get Your Files Here !/[3] 2. Working with Developers/[1] Common ground through standardization.srt

4.5 KB

/~Get Your Files Here !/[3] 2. Working with Developers/[2] Design systems.mp4

6.8 MB

/~Get Your Files Here !/[3] 2. Working with Developers/[2] Design systems.srt

4.4 KB

/~Get Your Files Here !/[3] 2. Working with Developers/[3] UX handoff deliverables.mp4

8.3 MB

 

Showing first 5 matched files of 30 total files

cn_sql_server_2014_developer_edition_x86_dvd_3938397.iso

2.4 GB

nfs-pc-redump

217.5 GB

/NFS-PC-REDUMP/Need for Speed - Underground (USA) (Speed Magazine Developer Interview).zip

12.8 MB

 

Showing first 1 matched files of 270 total files

[FTUApps.com] - Autodesk AutoCAD 2023.08 (x64) Portable

1.8 GB

/FTUApps.com Download Cracked Developers Applications For Free.url

0.2 KB

 

Showing first 1 matched files of 7 total files

The GOG Collection (Games) [T-Z]

5.0 GB

/U/uplink_hacker_elite/uplink_developer_interview.zip

0.0 KB

 

Showing first 1 matched files of 234 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/059 === ECS Lectures from Certified Developer Course ===.html

0.3 KB

 

Showing first 1 matched files of 234 total files

[FreeCourseSite.com] Udemy - Practical Git & Github Bootcamp for Developers

831.7 MB

/4. Working with Intellij editor & Git Github/4. Important Git operations that Developer must know.mp4

113.4 MB

 

Showing first 1 matched files of 19 total files

Assemble with Care

1.4 GB

/AWC_Data/Managed/com.unity-common.developer-panel.dll

198.1 KB

 

Showing first 1 matched files of 350 total files

Build an AutoGPT Code Writing AI Tool With Rust and GPT-4

8.8 GB

/9. Auto GPT Project - Create Agents/14. Backend Developer - Fix Code Bugs Fn.mp4

29.5 MB

/9. Auto GPT Project - Create Agents/15. Backend Developer - Rest API Endpoints Fn.mp4

47.1 MB

/9. Auto GPT Project - Create Agents/23. Backend Developer - Testing Code Rewrites.mp4

58.7 MB

/9. Auto GPT Project - Create Agents/22. Backend Developer - Unit Testing Agents Unit Tests.mp4

62.4 MB

/9. Auto GPT Project - Create Agents/16. Backend Developer - Discovery and Working States.mp4

69.4 MB

 

Showing first 5 matched files of 136 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/059 === ECS Lectures from Certified Developer Course ===.html

0.3 KB

 

Showing first 1 matched files of 242 total files

[FTUApps.com] - Perfectly Clear Video v4.3.0.2445 (x64) Pre-Activated

77.9 MB

/FTUApps.com Download Cracked Developers Applications For Free.url

0.2 KB

 

Showing first 1 matched files of 6 total files

[Tutorialsplanet.NET] Udemy - Microsoft Power BI - The Practical Guide [2022 EDITION]

12.2 GB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/001 Module Introduction.en.srt

1.3 KB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/001 Module Introduction.mp4

1.2 MB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/002 Why Custom Visuals_.en.srt

9.4 KB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/002 Why Custom Visuals_.mp4

18.1 MB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/003 The Required Tools.en.srt

5.0 KB

 

Showing first 5 matched files of 687 total files

Programming for Complete Beginners in C# with NET 7.0

2.6 GB

/1 - Introduction/3 - What Makes a Good Developer English.vtt

23.5 KB

/1 - Introduction/3 - What Makes a Good Developer.mp4

73.4 MB

 

Showing first 2 matched files of 80 total files

PIWIS 3 WIN10 41.500+38.250 VMWARE

114.6 GB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-8700f0e3.vmem

2.1 GB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-8700f0e3.vmem.lck/M12864.lck

0.5 KB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-8700f0e3.vmss

2.1 MB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-s001.vmdk

4.8 GB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-s002.vmdk

4.9 GB

 

Showing first 5 matched files of 289 total files

[Tutorialsplanet.NET] Udemy - Statistical Arbitrage Bot Build in Crypto with Python (A-Z)

6.6 GB

/11. Appendix - Python Coding Crash Course/2. A Developers Mindset.mp4

32.5 MB

/11. Appendix - Python Coding Crash Course/2. A Developers Mindset.srt

8.6 KB

 

Showing first 2 matched files of 192 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.mp4

44.3 MB

/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.srt

44.3 MB

 

Showing first 2 matched files of 612 total files


Copyright © 2025 FileMood.com