FileMood

Showing results 4220 to 4239 of about 5000 for developer

cn_sql_server_2014_developer_edition_x86_dvd_3938397.iso

2.4 GB

nfs-pc-redump

217.5 GB

/NFS-PC-REDUMP/Need for Speed - Underground (USA) (Speed Magazine Developer Interview).zip

12.8 MB
 

Showing first 1 matched files of 270 total files

[FTUApps.com] - ImageRanger Pro Edition v1.9.2.1847 (x64) Pre-Activated

118.8 MB

/FTUApps.com Download Cracked Developers Applications For Free.url

0.2 KB
 

Showing first 1 matched files of 6 total files

[FTUApps.com] - Autodesk AutoCAD 2023.08 (x64) Portable

1.8 GB

/FTUApps.com Download Cracked Developers Applications For Free.url

0.2 KB
 

Showing first 1 matched files of 7 total files

The GOG Collection (Games) [T-Z]

5.0 GB

/U/uplink_hacker_elite/uplink_developer_interview.zip

0.0 KB
 

Showing first 1 matched files of 234 total files

[FreeCourseSite.com] Udemy - User Experience Design Essentials - Adobe XD UI UX Design

5.8 GB

/89 How to export images & assets from Adobe XD for developers.en.srt

21.0 KB

/89 How to export images & assets from Adobe XD for developers.en.vtt

20.1 KB

/89 How to export images & assets from Adobe XD for developers.mp4

94.1 MB
 

Showing first 3 matched files of 282 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/059 === ECS Lectures from Certified Developer Course ===.html

0.3 KB
 

Showing first 1 matched files of 234 total files

[FreeCourseSite.com] Udemy - Practical Git & Github Bootcamp for Developers

831.7 MB

/4. Working with Intellij editor & Git Github/4. Important Git operations that Developer must know.mp4

113.4 MB
 

Showing first 1 matched files of 19 total files

Assemble with Care

1.4 GB

/AWC_Data/Managed/com.unity-common.developer-panel.dll

198.1 KB
 

Showing first 1 matched files of 350 total files

Build an AutoGPT Code Writing AI Tool With Rust and GPT-4

8.8 GB

/9. Auto GPT Project - Create Agents/14. Backend Developer - Fix Code Bugs Fn.mp4

29.5 MB

/9. Auto GPT Project - Create Agents/15. Backend Developer - Rest API Endpoints Fn.mp4

47.1 MB

/9. Auto GPT Project - Create Agents/23. Backend Developer - Testing Code Rewrites.mp4

58.7 MB

/9. Auto GPT Project - Create Agents/22. Backend Developer - Unit Testing Agents Unit Tests.mp4

62.4 MB

/9. Auto GPT Project - Create Agents/16. Backend Developer - Discovery and Working States.mp4

69.4 MB
 

Showing first 5 matched files of 136 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/059 === ECS Lectures from Certified Developer Course ===.html

0.3 KB
 

Showing first 1 matched files of 242 total files

[FTUApps.com] - Perfectly Clear Video v4.3.0.2445 (x64) Pre-Activated

77.9 MB

/FTUApps.com Download Cracked Developers Applications For Free.url

0.2 KB
 

Showing first 1 matched files of 6 total files

[Tutorialsplanet.NET] Udemy - Microsoft Power BI - The Practical Guide [2022 EDITION]

12.2 GB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/001 Module Introduction.en.srt

1.3 KB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/001 Module Introduction.mp4

1.2 MB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/002 Why Custom Visuals_.en.srt

9.4 KB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/002 Why Custom Visuals_.mp4

18.1 MB

/19 [OLD COURSE] Creating Custom Visuals (Power BI for Developers)/003 The Required Tools.en.srt

5.0 KB
 

Showing first 5 matched files of 687 total files

Programming for Complete Beginners in C# with NET 7.0

2.6 GB

/1 - Introduction/3 - What Makes a Good Developer English.vtt

23.5 KB

/1 - Introduction/3 - What Makes a Good Developer.mp4

73.4 MB
 

Showing first 2 matched files of 80 total files

PIWIS 3 WIN10 41.500+38.250 VMWARE

114.6 GB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-8700f0e3.vmem

2.1 GB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-8700f0e3.vmem.lck/M12864.lck

0.5 KB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-8700f0e3.vmss

2.1 MB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-s001.vmdk

4.8 GB

/PIWIS 3 WIN10 41.500+38.250 DEVELOPER + CODING ( VMWARE ) - nhanas-s002.vmdk

4.9 GB
 

Showing first 5 matched files of 289 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.mp4

44.3 MB

/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.srt

44.3 MB
 

Showing first 2 matched files of 612 total files

physics-for-game-developers-2e

208.6 MB

/physics for game developers 2e.pdf

18.1 MB

/physics for game developers 2e_abbyy.gz

14.4 MB

/physics for game developers 2e_djvu.txt

1.1 MB

/physics for game developers 2e_djvu.xml

10.7 MB

/physics for game developers 2e_jp2.zip

164.0 MB
 

Showing first 5 matched files of 10 total files

power-pc-microprocessor-developers-guide

500.1 MB

/PowerPC Microprocessor Developer's Guide.pdf

227.2 MB

/PowerPC Microprocessor Developer's Guide_chocr.html.gz

9.5 MB

/PowerPC Microprocessor Developer's Guide_djvu.txt

671.2 KB

/PowerPC Microprocessor Developer's Guide_djvu.xml

9.0 MB

/PowerPC Microprocessor Developer's Guide_hocr.html

17.0 MB
 

Showing first 5 matched files of 13 total files

[FTUApps.com] - ResumeMaker Professional Deluxe v20.2.1.5040 Pre-Activated

529.8 MB

/FTUApps.com Download Cracked Developers Applications For Free.url

0.2 KB
 

Showing first 1 matched files of 5 total files

VCpp2022_5

4.6 GB

/Installer/Win10SDK_10.0.19041,version=10.0.19041.3/Installers/Windows SDK Modern Non-Versioned Developer Tools-x86_en-us.msi

393.2 KB

/Installer/Win10SDK_10.0.19041,version=10.0.19041.3/Installers/Windows SDK Modern Versioned Developer Tools-x86_en-us.msi

397.3 KB
 

Showing first 2 matched files of 1211 total files
«« « Back Next » »»

Copyright © 2025 FileMood.com