FileMood

Showing results 28 to 47 of about 258 for elasticache

AWS Certified Cloud Practitioner 2020

9.2 GB

/[TutsNode.com] - AWS Certified Cloud Practitioner 2020/02 Understanding Core AWS Services/076 AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 237 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

UD151

11.5 GB

/11 Databases/187 Amazon ElastiCache Overview.mp4

33.8 MB

/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4

36.6 MB

/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4

56.2 MB

/11 Databases/190 ElastiCache Redis AUTH.mp4

7.4 MB

/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4

61.2 MB

 

Showing first 5 matched files of 275 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.mp4

44.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.srt

21.9 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.mp4

34.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.srt

18.6 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/4. Amazon ElastiCache - Caching Strategies.mp4

12.8 MB

 

Showing first 5 matched files of 1023 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB

 

Showing first 1 matched files of 138 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB

 

Showing first 2 matched files of 696 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB

 

Showing first 2 matched files of 612 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4

47.0 MB

 

Showing first 1 matched files of 120 total files

[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02

4.4 GB

/12 - Databases and Analytics/009 Amazon ElastiCache.mp4

14.6 MB

/12 - Databases and Analytics/009 Amazon ElastiCache_en.srt

6.9 KB

/12 - Databases and Analytics/010 Scaling ElastiCache.mp4

10.5 MB

/12 - Databases and Analytics/010 Scaling ElastiCache_en.srt

4.8 KB

/12 - Databases and Analytics/011 [HOL] Create ElastiCache Cluster.mp4

37.4 MB

 

Showing first 5 matched files of 411 total files

itpro.tv

163.2 GB

/Amazom/AWS Certified Solutions Architect - Associate/10.1 - Amazon ElastiCache.mp4

109.9 MB

 

Showing first 1 matched files of 865 total files

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program

7.1 GB

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4

134.7 MB

 

Showing first 1 matched files of 72 total files

[04-2022] docker-and-kubernetes-the-complete-guide

14.1 GB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt

6.5 KB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4

27.3 MB

 

Showing first 2 matched files of 662 total files

PacktPub - AWS Certified Cloud Practitioner (CLF-C01)

2.9 GB

/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4

35.1 MB

 

Showing first 1 matched files of 92 total files

[FreeCourseLab.com] Udemy - Ultimate AWS Certified Developer Associate 2019 - NEW!

1/0

6.3 GB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/1. AWS Fundamentals III - Section Introduction.mp4

11.5 MB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/1. AWS Fundamentals III - Section Introduction.vtt

0.7 KB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.mp4

17.1 MB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.vtt

7.7 KB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/3. AWS Route 53 Hands On.mp4

34.4 MB

 

Showing first 5 matched files of 385 total files

[UdemyCourseDownloader] DOCKER AND KUBERNETES THE COMPLETE GUIDE

0/1

12.3 GB

/11 Multi-Container Deployments to AWS/142 ElastiCache Redis Creation-en.srt

6.7 KB

/11 Multi-Container Deployments to AWS/142 ElastiCache Redis Creation.mp4

38.2 MB

 

Showing first 2 matched files of 520 total files

[FreeTutorials.Us] Udemy - AWS Certified Solutions Architect - Professional 2019

0/1

16.9 GB

/3. New Domain 2 - Design for New Solutions/66. Understanding ElastiCache in AWS.mp4

12.8 MB

/3. New Domain 2 - Design for New Solutions/66. Understanding ElastiCache in AWS.srt

5.8 KB

/3. New Domain 2 - Design for New Solutions/66. Understanding ElastiCache in AWS.vtt

5.1 KB

/3. New Domain 2 - Design for New Solutions/67. ElastiCache - Deploying Memcached Cluster Engine.mp4

28.3 MB

/3. New Domain 2 - Design for New Solutions/67. ElastiCache - Deploying Memcached Cluster Engine.srt

10.8 KB

 

Showing first 5 matched files of 727 total files

[FreeCourseLab.com] Udemy - AWS Certified Solutions Architect - Associate [New Exam]

1/0

18.8 GB

/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.mp4

34.5 MB

/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.vtt

16.5 KB

/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.mp4

12.8 MB

/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.vtt

5.6 KB

/21. AWS Services/3. AWS Services - 1-3) Elasticache for Memcached.mp4

16.0 MB

 

Showing first 5 matched files of 860 total files

[Tutorialsplanet.NET] Udemy - AWS Certified Developer - Associate 2020

0/1

8.4 GB

/3. Beginners Guide to EC2/11. Elasticache 101.mp4

65.8 MB

/3. Beginners Guide to EC2/11. Elasticache 101.vtt

9.2 KB

/6. DynamoDB/8. Elasticache.mp4

83.4 MB

/6. DynamoDB/8. Elasticache.vtt

10.5 KB

 

Showing first 4 matched files of 351 total files

[FreeCoursesOnline.Me] PacktPub - AWS Certified Cloud Practitioner (CLF-C01) [Video]

0/1

2.9 GB

/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4

35.1 MB

 

Showing first 1 matched files of 92 total files


Copyright © 2025 FileMood.com