|
11.5 GB |
||
|
33.8 MB |
/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4 |
36.6 MB |
/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4 |
56.2 MB |
|
7.4 MB |
/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4 |
61.2 MB |
Showing first 5 matched files of 275 total files |
[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam] |
|
25.4 GB |
|
|
44.5 MB |
|
21.9 KB |
|
34.5 MB |
|
18.6 KB |
|
12.8 MB |
Showing first 5 matched files of 1023 total files |
[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021 |
|
9.1 GB |
|
|
69.9 MB |
Showing first 1 matched files of 135 total files |
|
5.3 GB |
||
|
11.7 MB |
Showing first 1 matched files of 138 total files |
desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009 |
|
9.6 GB |
|
|
23.2 MB |
|
5.2 KB |
Showing first 2 matched files of 696 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
11.7 MB |
|
3.8 KB |
Showing first 2 matched files of 612 total files |
|
2.0 GB |
||
/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4 |
47.0 MB |
Showing first 1 matched files of 120 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023 |
|
14.7 GB |
|
|
9.1 KB |
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache.mp4 |
40.5 MB |
Showing first 2 matched files of 437 total files |
PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program |
|
7.1 GB |
|
|
134.7 MB |
Showing first 1 matched files of 72 total files |
|
14.1 GB |
||
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt |
6.5 KB |
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4 |
27.3 MB |
Showing first 2 matched files of 662 total files |
|
2.9 GB |
||
/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4 |
35.1 MB |
Showing first 1 matched files of 92 total files |
[FreeCourseLab.com] Udemy - Ultimate AWS Certified Developer Associate 2019 - NEW! |
1/0 |
6.3 GB |
|
|
11.5 MB |
|
0.7 KB |
/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.mp4 |
17.1 MB |
/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.vtt |
7.7 KB |
/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/3. AWS Route 53 Hands On.mp4 |
34.4 MB |
Showing first 5 matched files of 385 total files |
[Tutorialsplanet.NET] Udemy - Docker and Kubernetes The Complete Guide |
|
12.7 GB |
|
/11. Multi-Container Deployments to AWS/10. ElastiCache Redis Creation.mp4 |
38.2 MB |
/11. Multi-Container Deployments to AWS/10. ElastiCache Redis Creation.vtt |
5.9 KB |
Showing first 2 matched files of 547 total files |
[FreeCourseLab.com] Udemy - AWS Certified Solutions Architect - Associate 2018 |
1/0 |
8.5 GB |
|
|
10.9 MB |
|
5.4 KB |
Showing first 2 matched files of 267 total files |
[FreeCourseLab.com] Udemy - AWS Certified Solutions Architect - Associate [New Exam] |
1/0 |
18.8 GB |
|
/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.mp4 |
34.5 MB |
/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.vtt |
16.5 KB |
/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.mp4 |
12.8 MB |
/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.vtt |
5.6 KB |
/21. AWS Services/3. AWS Services - 1-3) Elasticache for Memcached.mp4 |
16.0 MB |
Showing first 5 matched files of 860 total files |
[Tutorialsplanet.NET] Udemy - AWS Certified Developer - Associate 2020 |
0/1 |
8.4 GB |
|
|
65.8 MB |
|
9.2 KB |
|
83.4 MB |
|
10.5 KB |
Showing first 4 matched files of 351 total files |
[FreeCoursesOnline.Me] PacktPub - AWS Certified Cloud Practitioner (CLF-C01) [Video] |
0/1 |
2.9 GB |
|
/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4 |
35.1 MB |
Showing first 1 matched files of 92 total files |
SAP-C01 AWS Certified Solution Architect Professional - DolphinEd |
0/1 |
13.2 GB |
|
|
141.9 MB |
Showing first 1 matched files of 123 total files |
[FreeCourseWorld.Com] Udemy - AWS Certified Big Data Specialty 2020 - In Depth & Hands On! |
0/1 |
5.4 GB |
|
|
3.7 KB |
|
11.7 MB |
Showing first 2 matched files of 270 total files |
[FreeCoursesOnline.Me] A Cloud Guru - AWS Certified SysOps Administrator - Associate 2020 |
0/1 |
4.8 GB |
|
|
14.1 KB |
|
24.1 MB |
|
27.4 MB |
Showing first 3 matched files of 169 total files |
Copyright © 2025 FileMood.com