|
3.7 GB |
||
|
0.1 KB |
|
13.0 MB |
Showing first 2 matched files of 182 total files |
[ FreeCourseWeb ] Udemy - COMPLETE- AWS Developer Certification |
|
3.2 GB |
|
/~Get Your Course Here !/8. Cloud Database/4. Elasticache.mp4 |
76.3 MB |
/~Get Your Course Here !/8. Cloud Database/4. Elasticache.vtt |
10.6 KB |
/~Get Your Course Here !/8. Cloud Database/5. Create an Instance Elasticache.mp4 |
25.1 MB |
/~Get Your Course Here !/8. Cloud Database/5. Create an Instance Elasticache.vtt |
3.5 KB |
Showing first 4 matched files of 142 total files |
|
6.7 GB |
||
|
13.0 MB |
Showing first 1 matched files of 140 total files |
[FTUForum.com] [UDEMY] COMPLETE- AWS Developer Certification [FTU] |
|
3.2 GB |
|
|
76.3 MB |
|
10.6 KB |
|
25.1 MB |
|
3.5 KB |
Showing first 4 matched files of 145 total files |
|
3.6 GB |
||
/aws-certified-cloud-practitioner-new/09 Databases Analytics/085 ElastiCache Overview.mp4 |
8.1 MB |
Showing first 1 matched files of 196 total files |
|
5.5 GB |
||
|
365.6 KB |
|
55.9 MB |
Showing first 2 matched files of 58 total files |
|
1.8 MB |
||
/Code/cookbook/chapter09/05_elasticache_clusters/elasticache.sls |
0.3 KB |
Showing first 1 matched files of 89 total files |
[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2020 |
|
9.1 GB |
|
|
69.9 MB |
Showing first 1 matched files of 135 total files |
|
9.2 GB |
||
|
69.9 MB |
Showing first 1 matched files of 237 total files |
[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021 |
|
9.1 GB |
|
|
69.9 MB |
Showing first 1 matched files of 135 total files |
|
11.5 GB |
||
|
33.8 MB |
/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4 |
36.6 MB |
/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4 |
56.2 MB |
|
7.4 MB |
/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4 |
61.2 MB |
Showing first 5 matched files of 275 total files |
[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam] |
|
25.4 GB |
|
|
44.5 MB |
|
21.9 KB |
|
34.5 MB |
|
18.6 KB |
|
12.8 MB |
Showing first 5 matched files of 1023 total files |
[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021 |
|
9.1 GB |
|
|
69.9 MB |
Showing first 1 matched files of 135 total files |
|
5.3 GB |
||
|
11.7 MB |
Showing first 1 matched files of 138 total files |
desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009 |
|
9.6 GB |
|
|
23.2 MB |
|
5.2 KB |
Showing first 2 matched files of 696 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
11.7 MB |
|
3.8 KB |
Showing first 2 matched files of 612 total files |
|
2.0 GB |
||
/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4 |
47.0 MB |
Showing first 1 matched files of 120 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023 |
|
14.7 GB |
|
|
9.1 KB |
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache.mp4 |
40.5 MB |
Showing first 2 matched files of 437 total files |
PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program |
|
7.1 GB |
|
|
134.7 MB |
Showing first 1 matched files of 72 total files |
|
14.1 GB |
||
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt |
6.5 KB |
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4 |
27.3 MB |
Showing first 2 matched files of 662 total files |
Copyright © 2025 FileMood.com