|
|
6.4 MB |
||
|
|
396.2 KB |
|
Showing first 1 matched files of 5 total files |
|
|
|
1.9 GB |
||
|
|
25.4 MB |
|
Showing first 1 matched files of 75 total files |
|
|
|
1.4 GB |
||
|
|
305.2 MB |
|
|
80.5 MB |
|
|
6.7 KB |
|
|
213.6 KB |
|
Showing first 4 matched files of 61 total files |
|
|
|
1.9 GB |
||
|
|
23.9 MB |
|
Showing first 1 matched files of 121 total files |
|
|
|
1.4 GB |
||
|
|
12.9 MB |
|
Showing first 1 matched files of 101 total files |
|
|
|
469.4 MB |
||
|
|
4.2 MB |
||
|
|
2.0 MB |
|
|
2.2 MB |
|
Showing first 2 matched files of 4 total files |
|
|
|
275.5 MB |
||
|
|
30.2 MB |
|
Showing first 1 matched files of 13 total files |
|
|
tutsgalaxy.-net-udemy-learn-dev-ops-the-complete-kubernetes-course |
|
4.4 GB |
|
|
/7. Serverless on Kubernetes/4. Demo Triggering Kubeless Functions with Kafka.mp4 |
94.4 MB |
|
/7. Serverless on Kubernetes/4. Demo Triggering Kubeless Functions with Kafka.vtt |
13.1 KB |
|
Showing first 2 matched files of 532 total files |
|
|
[Tutorialsplanet.NET] Udemy - Microservices Clean Architecture, DDD, SAGA, Outbox & Kafka |
|
12.2 GB |
|
|
|
16.4 MB |
||
|
|
16.4 MB |
||
|
|
105.0 MB |
||
|
[Sakamoto Kafka] Kourin! Akuma Friends - Advent! Devil Friends [Digital] |
|
125.7 MB |
|
|
|
163.3 MB |
||
|
|
64.1 GB |
||
|
|
5.9 GB |
|
Showing first 1 matched files of 13 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
/2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.mp4 |
47.3 MB |
|
/2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.srt |
15.9 KB |
|
Showing first 2 matched files of 612 total files |
|
|
|
249.8 MB |
||
|
|
394.6 MB |
||
|
|
63.8 MB |
||
Copyright © 2025 FileMood.com
