|
1.9 GB |
||
|
23.9 MB |
Showing first 1 matched files of 121 total files |
|
1.4 GB |
||
|
12.9 MB |
Showing first 1 matched files of 101 total files |
|
469.4 MB |
||
|
4.2 MB |
||
|
2.0 MB |
|
2.2 MB |
Showing first 2 matched files of 4 total files |
|
275.5 MB |
||
|
30.2 MB |
Showing first 1 matched files of 13 total files |
tutsgalaxy.-net-udemy-learn-dev-ops-the-complete-kubernetes-course |
|
4.4 GB |
|
/7. Serverless on Kubernetes/4. Demo Triggering Kubeless Functions with Kafka.mp4 |
94.4 MB |
/7. Serverless on Kubernetes/4. Demo Triggering Kubeless Functions with Kafka.vtt |
13.1 KB |
Showing first 2 matched files of 532 total files |
[Tutorialsplanet.NET] Udemy - Microservices Clean Architecture, DDD, SAGA, Outbox & Kafka |
|
12.2 GB |
|
|
16.4 MB |
||
[ DevCourseWeb.com ] Udemy - Event-Driven Microservices - Spring Boot, Kafka and Elastic |
|
4.0 GB |
|
/~Get Your Files Here !/10/001 Introduction to Kafka streams.mp4 |
10.8 MB |
/~Get Your Files Here !/10/001 Introduction to Kafka streams_en.srt |
3.0 KB |
/~Get Your Files Here !/10/002 Kafka streams microservice base project.mp4 |
17.2 MB |
/~Get Your Files Here !/10/002 Kafka streams microservice base project_en.srt |
7.0 KB |
/~Get Your Files Here !/10/003 Completing the Kafka streams microservice.mp4 |
33.8 MB |
Showing first 5 matched files of 3550 total files |
|
105.0 MB |
||
[Sakamoto Kafka] Kourin! Akuma Friends - Advent! Devil Friends [Digital] |
|
125.7 MB |
|
|
163.3 MB |
||
[FreeCourseSite.com] Udemy - Complete Machine Learning & Data Science Bootcamp 2022 |
|
17.5 GB |
|
|
15.1 MB |
/13 - Data Engineering/013 Kafka and Stream Processing__en.srt |
5.3 KB |
Showing first 2 matched files of 735 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.mp4 |
47.3 MB |
/2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.srt |
15.9 KB |
Showing first 2 matched files of 612 total files |
|
249.8 MB |
||
|
394.6 MB |
||
|
63.8 MB |
||
[Яндекс.Практикум] Инженер данных. Data Engineer. Весь курс (2022) |
|
6.8 GB |
|
|
14.3 KB |
/08 Потоковая обработка данных/Воркшоп по Kafka _ Чащина Александра _ 0904_2.mp4 |
542.3 MB |
/08 Потоковая обработка данных/02 Потоковая обработка с Kafka и Spark/01 Введение.html |
9.0 KB |
|
59.5 KB |
/08 Потоковая обработка данных/02 Потоковая обработка с Kafka и Spark/02.mp4 |
904.5 KB |
Showing first 5 matched files of 2280 total files |
[Sakamoto Kafka] Chika Tose 地下生活 [Chinese] [沒有漢化] [Ongoing] [Digital].zip |
|
42.2 MB |
|
(Cosplay) Sayo Momo cosplay cosplay Kafka – HonkaiStar Rail.zip |
|
36.7 MB |
|
Copyright © 2025 FileMood.com