desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
11.7 MB |
|
3.8 KB |
Showing first 2 matched files of 612 total files |
|
2.0 GB |
||
/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4 |
47.0 MB |
Showing first 1 matched files of 120 total files |
|
1.3 GB |
||
|
15.3 MB |
Showing first 1 matched files of 102 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023 |
|
14.7 GB |
|
|
9.1 KB |
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache.mp4 |
40.5 MB |
Showing first 2 matched files of 437 total files |
|
1.7 GB |
||
|
6.1 MB |
Showing first 1 matched files of 21 total files |
|
105.1 GB |
||
|
72.9 MB |
Showing first 1 matched files of 1784 total files |
ManyVids.22.12.06..Completely.Candid.Taboo.Confessional.2 (4).XXX |
|
7.7 GB |
|
|
136.3 MB |
Showing first 1 matched files of 48 total files |
|
3.5 GB |
||
|
5.7 GB |
||
/2021 - DOOM 2 in Spain Only (Soundtrack)/02. Cama Elástica.mp3 |
7.2 MB |
Showing first 1 matched files of 385 total files |
|
1.9 GB |
||
/2016 - Cryocloned (15th Anniversary Edition)/04. elastica.mp3 |
8.1 MB |
Showing first 1 matched files of 245 total files |
|
103.4 MB |
||
|
16.2 MB |
|
15.7 MB |
|
14.3 MB |
|
11.8 MB |
|
9.4 MB |
Showing first 5 matched files of 11 total files |
|
6.3 GB |
||
/2021 - DOOM 2 in Spain Only (Soundtrack)/02. Cama Elástica.mp3 |
7.2 MB |
Showing first 1 matched files of 452 total files |
PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program |
|
7.1 GB |
|
|
134.7 MB |
Showing first 1 matched files of 72 total files |
|
21.6 GB |
||
|
10.1 MB |
Showing first 1 matched files of 2460 total files |
|
14.1 GB |
||
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt |
6.5 KB |
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4 |
27.3 MB |
Showing first 2 matched files of 662 total files |
[ FreeCourseWeb.com ] Build Microservices with Python and AWS |
|
3.4 GB |
|
|
2.2 KB |
|
223.0 KB |
|
3.7 KB |
|
111.6 KB |
|
3.0 KB |
Showing first 5 matched files of 3063 total files |
|
2.9 GB |
||
/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4 |
35.1 MB |
Showing first 1 matched files of 92 total files |
|
1.6 GB |
||
|
13.6 MB |
Showing first 1 matched files of 151 total files |
|
1.0 GB |
||
|
5.8 MB |
Showing first 1 matched files of 101 total files |
1/0 |
2.9 GB |
||
/CMJ 1995-04/01. Elastica - Car Song (CMJ New Music Monthly, Vol 020, 1995-04).flac |
15.6 MB |
Showing first 1 matched files of 127 total files |
Copyright © 2025 FileMood.com