FileMood

Showing results 67 to 86 of about 1338 for elastica

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB

 

Showing first 2 matched files of 612 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4

47.0 MB

 

Showing first 1 matched files of 120 total files

Beatport Hard Dance. Electro Sound Pack #319

1.3 GB

/086. Elastica & Jesus Elices - Tahikiry.mp3

15.3 MB

 

Showing first 1 matched files of 102 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023

14.7 GB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache English.vtt

9.1 KB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache.mp4

40.5 MB

 

Showing first 2 matched files of 437 total files

猜火车.1996.[WAF]

1.7 GB

/猜火车原声碟/11 2-1 performed by Elastica.mp3

6.1 MB

 

Showing first 1 matched files of 21 total files

Extensivo ITA IME Estrategia Militares 2023

105.1 GB

/9. Física I/4. os principios da dinamica, as leis de newton, equilibrios de um corpo, forcas em fios, vinculos geometricos/10. Força Elástica (A) - Toni Burgatto_mp4/ext1.mp4

72.9 MB

 

Showing first 1 matched files of 1784 total files

ManyVids.22.12.06..Completely.Candid.Taboo.Confessional.2 (4).XXX

7.7 GB

/How elastic is the vagina and the skin of the breasts? Que tan Elástica es la vagina y la piel de lo.mp4

136.3 MB

 

Showing first 1 matched files of 48 total files

Elastica Lossless

3.5 GB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/01 - Connection.flac

14.6 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/02 - See That Animal.flac

16.7 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/03 - Blue (4 track demo).flac

9.2 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/04 - Spastica.flac

18.6 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/Connection.cue

0.5 KB

 

Showing first 5 matched files of 310 total files

DOOM Soundtrack Collection by Various Artists

5.7 GB

/2021 - DOOM 2 in Spain Only (Soundtrack)/02. Cama Elástica.mp3

7.2 MB

 

Showing first 1 matched files of 385 total files

Mulphia

1.9 GB

/2016 - Cryocloned (15th Anniversary Edition)/04. elastica.mp3

8.1 MB

 

Showing first 1 matched files of 245 total files

[Ujanskiy] Elastica

103.4 MB

/Elastica81.png

16.2 MB

/Elastica8.png

15.7 MB

/Elastica82.png

14.3 MB

/Elastica7.png

11.8 MB

/Elastica6.png

9.4 MB

 

Showing first 5 matched files of 11 total files

DOOM Soundtrack Collection by Various Artists

6.3 GB

/2021 - DOOM 2 in Spain Only (Soundtrack)/02. Cama Elástica.mp3

7.2 MB

 

Showing first 1 matched files of 452 total files

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program

7.1 GB

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4

134.7 MB

 

Showing first 1 matched files of 72 total files

Tunnel Trance Force

21.6 GB

/Tunnel Trance Force Vol.17/2001 - Tunnel Trance Force Vol.17 - CD1 - Sunshine Mix/(15) [Elastica] The Audience (Extended Mix).mp3

10.1 MB

 

Showing first 1 matched files of 2460 total files

[04-2022] docker-and-kubernetes-the-complete-guide

14.1 GB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt

6.5 KB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4

27.3 MB

 

Showing first 2 matched files of 662 total files

[ FreeCourseWeb.com ] Build Microservices with Python and AWS

3.4 GB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/paginators-1.json

2.2 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/service-2.json

223.0 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/waiters-2.json

3.7 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2015-02-02/examples-1.json

111.6 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2015-02-02/paginators-1.json

3.0 KB

 

Showing first 5 matched files of 3063 total files

PacktPub - AWS Certified Cloud Practitioner (CLF-C01)

2.9 GB

/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4

35.1 MB

 

Showing first 1 matched files of 92 total files

BP Chill Electronic_ Sound Pack _683

1.6 GB

/100. Fabel - Elastica.mp3

13.6 MB

 

Showing first 1 matched files of 151 total files

80s Rock Songs Essentials

1.0 GB

/090. Elastica - Connection.mp3

5.8 MB

 

Showing first 1 matched files of 101 total files

CMJ Assortment

1/0

2.9 GB

/CMJ 1995-04/01. Elastica - Car Song (CMJ New Music Monthly, Vol 020, 1995-04).flac

15.6 MB

 

Showing first 1 matched files of 127 total files


Copyright © 2025 FileMood.com