FileMood

Showing results 70 to 89 of about 1339 for elastica

Week 9 Mp3 25.04.2021 TSP RG

19.8 GB

/Mash-Up Singles Collection Part 5/Elastica vs. Mya ft. Missy Elliott - Love Is Never Here (McSleazy Bootleg) (252).mp3

8.5 MB

 

Showing first 1 matched files of 1691 total files

MutzNutz Music Pack 055 2021 - [ ANT ]

8.8 GB

/MutzNutz Music Pack 055 2021/NOW Live Forever_ The Anthems (4CD) (2021)/CD 2/12. Elastica - Connection.mp3

5.8 MB

 

Showing first 1 matched files of 922 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB

 

Showing first 1 matched files of 138 total files

AWS Certified Cloud Practitioner - Complete NEW Course 2021

6.1 GB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-fr_FR.srt

12.0 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-de_DE.srt

11.3 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-id_ID.srt

11.3 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-pt_BR.srt

11.1 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/7. DNS, Elastic Load Balancing, and Auto Scaling/10. [HOL] Elastically Scale the Application-it_IT.srt

11.1 KB

 

Showing first 5 matched files of 1644 total files

Brit Pop Essentials (2022)

532.9 MB

/15. Elastica - Line Up.mp3

8.7 MB

 

Showing first 1 matched files of 50 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB

 

Showing first 2 matched files of 696 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB

 

Showing first 2 matched files of 612 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4

47.0 MB

 

Showing first 1 matched files of 120 total files

猜火车.1996.[WAF]

1.7 GB

/猜火车原声碟/11 2-1 performed by Elastica.mp3

6.1 MB

 

Showing first 1 matched files of 21 total files

VA-Promo Only Modern Rock Radio

35.1 GB

/1995 - VA-Promo Only Modern Rock Radio/02. VA-Promo Only Modern Rock December-1995/10. Elastica - Car Song.mp3

3.6 MB

 

Showing first 1 matched files of 6322 total files

Extensivo ITA IME Estrategia Militares 2023

105.1 GB

/9. Física I/4. os principios da dinamica, as leis de newton, equilibrios de um corpo, forcas em fios, vinculos geometricos/10. Força Elástica (A) - Toni Burgatto_mp4/ext1.mp4

72.9 MB

 

Showing first 1 matched files of 1784 total files

VA-Promo Only Modern Rock Radio

37.8 GB

/1995 - VA-Promo Only Modern Rock Radio/02. VA-Promo Only Modern Rock December-1995/10. Elastica - Car Song.mp3

3.6 MB

 

Showing first 1 matched files of 6675 total files

Elastica Lossless

3.5 GB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/01 - Connection.flac

14.6 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/02 - See That Animal.flac

16.7 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/03 - Blue (4 track demo).flac

9.2 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/04 - Spastica.flac

18.6 MB

/1. Singles and EP/1994. Elastica - Connection (Deceptive BLUFF 010CD)/Connection.cue

0.5 KB

 

Showing first 5 matched files of 310 total files

DOOM Soundtrack Collection by Various Artists

5.7 GB

/2021 - DOOM 2 in Spain Only (Soundtrack)/02. Cama Elástica.mp3

7.2 MB

 

Showing first 1 matched files of 385 total files

Mulphia

1.9 GB

/2016 - Cryocloned (15th Anniversary Edition)/04. elastica.mp3

8.1 MB

 

Showing first 1 matched files of 245 total files

[Ujanskiy] Elastica

103.4 MB

/Elastica81.png

16.2 MB

/Elastica8.png

15.7 MB

/Elastica82.png

14.3 MB

/Elastica7.png

11.8 MB

/Elastica6.png

9.4 MB

 

Showing first 5 matched files of 11 total files

SubUrbia (Original Soundtrack) - VA (1996) [FLAC]

387.0 MB

/01. Elastica - Unheard Music (feat. Stephen Malkmus).flac

19.2 MB

 

Showing first 1 matched files of 18 total files

DOOM Soundtrack Collection by Various Artists

6.3 GB

/2021 - DOOM 2 in Spain Only (Soundtrack)/02. Cama Elástica.mp3

7.2 MB

 

Showing first 1 matched files of 452 total files

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program

7.1 GB

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4

134.7 MB

 

Showing first 1 matched files of 72 total files

[04-2022] docker-and-kubernetes-the-complete-guide

14.1 GB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt

6.5 KB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4

27.3 MB

 

Showing first 2 matched files of 662 total files


Copyright © 2025 FileMood.com