FileMood

Showing results 80 to 99 of about 1339 for elastica

ICE MC (1990-2004)

3.0 GB

/ICE MC - 2004 - Cold Skool (DWA, M4 02, WEB)/12 - Elastica.flac

25.7 MB

 

Showing first 1 matched files of 148 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

UD151

11.5 GB

/11 Databases/187 Amazon ElastiCache Overview.mp4

33.8 MB

/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4

36.6 MB

/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4

56.2 MB

/11 Databases/190 ElastiCache Redis AUTH.mp4

7.4 MB

/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4

61.2 MB

 

Showing first 5 matched files of 275 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.mp4

44.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.srt

21.9 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.mp4

34.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.srt

18.6 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/4. Amazon ElastiCache - Caching Strategies.mp4

12.8 MB

 

Showing first 5 matched files of 1023 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

EDC Radio Clubbing Sound

1.7 GB

/069. Elastica & Aftertouch - I'm Wild.mp3

13.4 MB

 

Showing first 1 matched files of 151 total files

Curso Stories Animados - Caio Vinicius

3.1 GB

/09 - Animação para Show e Eventos - Avançado/4 - Criando banner animado com expressão elástica (Segredo Revelado)/copie e cole.txt

0.4 KB

/09 - Animação para Show e Eventos - Avançado/4 - Criando banner animado com expressão elástica (Segredo Revelado)/Hotmart Club - 3 - Criando banner animado com expressão elástica (Segredo Revelado).MP4

68.2 MB

/09 - Animação para Show e Eventos - Avançado/5 - Animando imagens com expressão elástica/copie e cole.txt

0.4 KB

/09 - Animação para Show e Eventos - Avançado/5 - Animando imagens com expressão elástica/Hotmart Club - 5 - Animando imagens com expressão elástica.MP4

91.9 MB

 

Showing first 4 matched files of 139 total files

MP3-daily-2021-March-22-Hardcore

547.3 MB

/VA-Nothing_But____Hard_Dance_Selections_Vol._14-NBHDS14-WEB-2021-COS_INT/09-elastica_and_jesus_elices-tahikiry_(japan_mix_remastered).mp3

15.2 MB

 

Showing first 1 matched files of 68 total files

MP3-daily-2021-February-01-Euro-House

1.4 GB

/VA-Blanco_Y_Negro_Mix_8-MXCD_1160_CD_CTV-3CD-2001-iNViNCiBLE_iNT/307-va-elastica_presents_jesus_elices_-_maximicing_the_audience-inv.mp3

12.2 MB

 

Showing first 1 matched files of 208 total files

VA - EDC Radio Clubbing Sound (2021)

1.7 GB

/069. Elastica & Aftertouch - I'm Wild.mp3

13.4 MB

 

Showing first 1 matched files of 152 total files

NOW Live Forever: The Anthems (4CD) (2021) Mp3 320kbps [PMEDIA] ⭐️

852.7 MB

/CD 2/12. Elastica - Connection.mp3

5.8 MB

 

Showing first 1 matched files of 85 total files

Week 9 Mp3 25.04.2021 TSP RG

19.8 GB

/Mash-Up Singles Collection Part 5/Elastica vs. Mya ft. Missy Elliott - Love Is Never Here (McSleazy Bootleg) (252).mp3

8.5 MB

 

Showing first 1 matched files of 1691 total files

MutzNutz Music Pack 055 2021 - [ ANT ]

8.8 GB

/MutzNutz Music Pack 055 2021/NOW Live Forever_ The Anthems (4CD) (2021)/CD 2/12. Elastica - Connection.mp3

5.8 MB

 

Showing first 1 matched files of 922 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB

 

Showing first 1 matched files of 138 total files

Brit Pop Essentials (2022)

532.9 MB

/15. Elastica - Line Up.mp3

8.7 MB

 

Showing first 1 matched files of 50 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB

 

Showing first 2 matched files of 696 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB

 

Showing first 2 matched files of 612 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4

47.0 MB

 

Showing first 1 matched files of 120 total files

[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02

4.4 GB

/12 - Databases and Analytics/009 Amazon ElastiCache.mp4

14.6 MB

/12 - Databases and Analytics/009 Amazon ElastiCache_en.srt

6.9 KB

/12 - Databases and Analytics/010 Scaling ElastiCache.mp4

10.5 MB

/12 - Databases and Analytics/010 Scaling ElastiCache_en.srt

4.8 KB

/12 - Databases and Analytics/011 [HOL] Create ElastiCache Cluster.mp4

37.4 MB

 

Showing first 5 matched files of 411 total files

itpro.tv

163.2 GB

/Amazom/AWS Certified Solutions Architect - Associate/10.1 - Amazon ElastiCache.mp4

109.9 MB

 

Showing first 1 matched files of 865 total files


Copyright © 2025 FileMood.com