|
|
13.2 GB |
||
|
|
2.9 MB |
|
Showing first 1 matched files of 181 total files |
|
|
[Rebrain] Архитектор высоких нагрузок Практикум HighLoad (2021) |
|
9.4 GB |
|
|
|
1.7 KB |
|
|
562.8 KB |
|
Showing first 2 matched files of 104 total files |
|
|
[Яндекс.Практикум] Инженер данных. Data Engineer. Весь курс (2022) |
|
6.8 GB |
|
|
07 Организация Data Lake/03 Знакомство со Spark/02 Парадигма MapReduce.html |
41.0 KB |
|
07 Организация Data Lake/03 Знакомство со Spark/data_files/2._Paradigma_MapReduce_1_1_1660748320.png |
197.5 KB |
|
07 Организация Data Lake/03 Знакомство со Spark/data_files/2._Paradigma_MapReduce_1659105232.png |
512.8 KB |
|
Showing first 3 matched files of 2280 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
4. Domain 3 Processing/13. Elastic MapReduce (EMR) Architecture and Usage.mp4 |
33.9 MB |
|
4. Domain 3 Processing/13. Elastic MapReduce (EMR) Architecture and Usage.srt |
9.7 KB |
|
4. Domain 3 Processing/26. [Exercise] Elastic MapReduce, Part 1.mp4 |
103.8 MB |
|
4. Domain 3 Processing/26. [Exercise] Elastic MapReduce, Part 1.srt |
16.3 KB |
|
4. Domain 3 Processing/27. [Exercise] Elastic MapReduce, Part 2.mp4 |
116.7 MB |
|
Showing first 5 matched files of 612 total files |
|
|
[FreeCourseSite.com] Udemy - Complete Machine Learning & Data Science Bootcamp 2022 |
|
17.5 GB |
|
|
|
5.4 MB |
|
13 - Data Engineering/011 Hadoop, HDFS and MapReduce__en.srt |
5.1 KB |
|
Showing first 2 matched files of 735 total files |
|
|
[GigaCourse.Com] Udemy - Complete SQL and Databases Bootcamp Zero to Mastery 2023 |
|
16.3 GB |
|
|
|
5.2 KB |
|
12 - Extras Data Engineering And the role of Machine Learning/262 - Hadoop HDFS and MapReduce.mp4 |
7.3 MB |
|
Showing first 2 matched files of 553 total files |
|
|
|
13.9 GB |
||
|
|
132.1 MB |
|
|
208.1 MB |
|
|
134.7 MB |
|
|
213.6 MB |
|
Showing first 4 matched files of 172 total files |
|
|
|
359.8 MB |
||
|
Udemy - Big Data Training Course 2021/10. Big Data - MapReduce Algorithm.mp4 |
33.5 MB |
|
Showing first 1 matched files of 14 total files |
|
|
|
5.3 GB |
||
|
04 Domain 3 Processing/057 Elastic MapReduce (EMR) Architecture and Usage.mp4 |
33.9 MB |
|
04 Domain 3 Processing/070 [Exercise] Elastic MapReduce Part 1.mp4 |
103.7 MB |
|
04 Domain 3 Processing/071 [Exercise] Elastic MapReduce Part 2.mp4 |
116.7 MB |
|
Showing first 3 matched files of 138 total files |
|
|
|
594.8 MB |
||
|
|
18.2 MB |
|
Showing first 1 matched files of 26 total files |
|
|
[Udemy] Taming Big Data with Apache Spark and Python - Hands On! (2020) [En] |
|
4.0 GB |
|
|
5. Running Spark on a Cluster/1. Introducing Elastic MapReduce.mp4 |
50.3 MB |
|
5. Running Spark on a Cluster/1. Introducing Elastic MapReduce.srt |
9.3 KB |
|
|
118.1 MB |
|
|
118.2 MB |
|
Showing first 4 matched files of 183 total files |
|
|
[FreeCourseSite.com] Udemy - Taming Big Data with Apache Spark and Python - Hands On! |
|
4.0 GB |
|
|
5. Running Spark on a Cluster/1. Introducing Elastic MapReduce.mp4 |
50.3 MB |
|
5. Running Spark on a Cluster/1. Introducing Elastic MapReduce.srt |
9.3 KB |
|
|
118.1 MB |
|
|
118.2 MB |
|
Showing first 4 matched files of 186 total files |
|
|
[FreeCoursesOnline.Me] PacktPub - Big Data for Architects [Video] |
|
5.3 GB |
|
|
|
64.2 MB |
|
|
9.3 MB |
|
Showing first 2 matched files of 68 total files |
|
|
[FreeCourseSite.com] Udemy - Taming Big Data with Apache Spark and Python - Hands On! |
|
4.0 GB |
|
|
5. Running Spark on a Cluster/1. Introducing Elastic MapReduce.mp4 |
50.3 MB |
|
5. Running Spark on a Cluster/1. Introducing Elastic MapReduce.srt |
9.3 KB |
|
|
118.1 MB |
|
|
118.2 MB |
|
Showing first 4 matched files of 186 total files |
|
|
[FreeCourseSite.com] Udemy - The Ultimate Hands-On Hadoop Tame your Big Data! |
|
3.3 GB |
|
|
|
1.5 GB |
||
|
|
25.2 MB |
|
Showing first 1 matched files of 21 total files |
|
|
|
255.9 MB |
||
|
|
1.3 MB |
|
Showing first 1 matched files of 242 total files |
|
|
[FreeCourseWorld.Com] Udemy - Apache Spark with Scala - Hands On with Big Data! |
|
6.9 GB |
|
|
5. Running Spark on a Cluster/3. Introducing Amazon Elastic MapReduce.mp4 |
138.4 MB |
|
5. Running Spark on a Cluster/3. Introducing Amazon Elastic MapReduce.srt |
13.4 KB |
|
Showing first 2 matched files of 122 total files |
|
|
|
18.9 GB |
||
|
|
53.5 MB |
|
Showing first 1 matched files of 76 total files |
|
|
|
23.8 GB |
||
|
|
105.7 MB |
|
Showing first 1 matched files of 197 total files |
|
Copyright © 2026 FileMood.com