|
6.2 GB |
||
|
75.7 MB |
|
23.7 KB |
|
73.3 MB |
/07 - Technology Stack/049 Elasticsearch architecture_en.srt |
23.8 KB |
Showing first 4 matched files of 513 total files |
[ DevCourseWeb.com ] Udemy - Oracle Database and ELK Stack - Let's do Data Visualization |
|
573.1 MB |
|
/~Get Your Files Here !/5. Elasticsearch, Kibana, and Logstash Installation and Configuration.mp4 |
116.5 MB |
|
74.7 MB |
Showing first 2 matched files of 14 total files |
|
9.6 MB |
||
|
8.1 MB |
Showing first 1 matched files of 5 total files |
|
10.3 MB |
||
|
8.8 MB |
Showing first 1 matched files of 5 total files |
|
7.8 MB |
||
|
6.3 MB |
Showing first 1 matched files of 5 total files |
[MEGASLIV.BIZ] [SkillBox] Профессия Python-разработчик (2022) |
|
41.1 GB |
|
|
98.5 MB |
Showing first 1 matched files of 1367 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/6. Domain 4 Analysis/10. [Exercise] Amazon Elasticsearch Service, Part 2.mp4 |
86.0 MB |
/6. Domain 4 Analysis/10. [Exercise] Amazon Elasticsearch Service, Part 2.srt |
13.4 KB |
/6. Domain 4 Analysis/11. [Exercise] Amazon Elasticsearch Service, Part 3.mp4 |
59.3 MB |
/6. Domain 4 Analysis/11. [Exercise] Amazon Elasticsearch Service, Part 3.srt |
8.9 KB |
|
63.3 MB |
Showing first 5 matched files of 612 total files |
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
/05 - Monitoring and Logging (Domain 3)/027 Amazon ES - ElasticSearch + Logstash + Kibana.mkv |
11.4 MB |
Showing first 1 matched files of 242 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
/05 - Monitoring and Logging (Domain 3)/027 Amazon ES - ElasticSearch + Logstash + Kibana.mkv |
11.4 MB |
Showing first 1 matched files of 234 total files |
[ DevCourseWeb.com ] Udemy - Event-Driven Microservices - Spring Boot, Kafka and Elastic |
|
4.0 GB |
|
|
2.1 KB |
|
0.4 KB |
|
0.5 KB |
|
2.1 KB |
|
0.4 KB |
Showing first 5 matched files of 3550 total files |
[GigaCourse.Com] Udemy - Complete SQL and Databases Bootcamp Zero to Mastery 2023 |
|
16.3 GB |
|
/10 - Database Landscape Performance and Security/244 - Elasticsearch English.srt |
4.9 KB |
/10 - Database Landscape Performance and Security/244 - Elasticsearch.mp4 |
33.6 MB |
Showing first 2 matched files of 553 total files |
[Tutorialsplanet.NET] Udemy - Developer To Architect Mastering Software Architecture |
|
9.7 GB |
|
|
20.0 KB |
|
125.3 MB |
|
19.1 KB |
|
126.1 MB |
Showing first 4 matched files of 512 total files |
|
5.3 GB |
||
|
63.3 MB |
|
59.3 MB |
/05 Domain 4 Analysis/089 [Exercise] Amazon Elasticsearch Service Part 1.mp4 |
94.8 MB |
/05 Domain 4 Analysis/090 [Exercise] Amazon Elasticsearch Service Part 2.mp4 |
86.0 MB |
/05 Domain 4 Analysis/091 [Exercise] Amazon Elasticsearch Service Part 3.mp4 |
59.2 MB |
Showing first 5 matched files of 138 total files |
|
1.9 GB |
||
|
10.6 MB |
Showing first 1 matched files of 75 total files |
|
411.7 MB |
||
|
8.0 MB |
|
305.2 KB |
Showing first 2 matched files of 80 total files |
|
1.6 GB |
||
|
10.6 MB |
Showing first 1 matched files of 69 total files |
[FreeCourseSite.com] Udemy - Complete Elasticsearch Masterclass with Logstash and Kibana |
|
4.6 GB |
|
/1. Introduction/2. Lecture 2 Setting up Elasticsearch and Kibana.mp4 |
207.1 MB |
/1. Introduction/2. Lecture 2 Setting up Elasticsearch and Kibana.vtt |
26.5 KB |
|
107.2 MB |
|
15.2 KB |
/4. Querying Elasticsearch/1. Follow these instructions before starting Lecture 10.html |
6.1 KB |
Showing first 5 matched files of 89 total files |
|
594.8 MB |
||
|
23.1 MB |
Showing first 1 matched files of 26 total files |
|
1.6 GB |
||
|
10.6 MB |
Showing first 1 matched files of 70 total files |
|
1.0 GB |
||
|
9.4 MB |
Showing first 1 matched files of 70 total files |
Copyright © 2025 FileMood.com