|
[ CourseBoat.com ] Exam MD-101 Managing Modern Desktops (Video), 2nd Edition |
|
8.1 GB |
|
|
~Get Your Files Here !/46-8.8 Manage enterprise-level disk encryption.en.srt |
20.7 KB |
|
~Get Your Files Here !/46-8.8 Manage enterprise-level disk encryption.mp4 |
225.0 MB |
|
Showing first 2 matched files of 144 total files |
|
|
[ DevCourseWeb.com ] Udemy - Certified Ethical Hacker (CEHv12) Practical hands on Labs |
|
3.4 GB |
|
|
[ TutPig.com ] Udemy - Information Security Fundamentals (Best Starting Point) |
|
2.3 GB |
|
|
~Get Your Files Here !/8. Encryption/1. What is Encryption.mp4 |
14.9 MB |
|
~Get Your Files Here !/8. Encryption/1.1 8.1 What is encryption.pdf |
711.7 KB |
|
~Get Your Files Here !/8. Encryption/2. Types of Encryption.mp4 |
54.3 MB |
|
~Get Your Files Here !/8. Encryption/2.1 8.2 Types of Encryption.pdf |
301.7 KB |
|
Showing first 4 matched files of 67 total files |
|
|
|
1.1 GB |
||
|
[GigaCourse.Com] Udemy - The Complete 2023 Web Development Bootcamp |
|
43.5 GB |
|
|
38 - Authentication Security/288 - Level 2 Database Encryption English.srt |
21.5 KB |
|
38 - Authentication Security/288 - Level 2 Database Encryption.mp4 |
169.7 MB |
|
Showing first 2 matched files of 957 total files |
|
|
Xia Q. Attribute-based Encryption (ABE). Foundations and Applications...2023 |
|
5.2 MB |
|
|
/Xia Q. Attribute-based Encryption (ABE). Foundations and Applications...2023.pdf |
5.2 MB |
|
1 matched files |
|
|
|
28.6 GB |
||
|
|
175.9 MB |
|
Showing first 1 matched files of 540 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
|
44.1 MB |
|
|
12.8 KB |
|
|
33.7 MB |
|
|
10.0 KB |
|
|
44.1 MB |
|
Showing first 5 matched files of 612 total files |
|
|
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/032 CodePipeline - Artifacts, Encryption and S3.mkv |
35.7 MB |
|
Showing first 1 matched files of 242 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/032 CodePipeline - Artifacts, Encryption and S3.mkv |
35.7 MB |
|
Showing first 1 matched files of 234 total files |
|
|
[ CourseHulu.com ] Cloud Academy - Device and Application Protection in Microsoft 365 |
|
530.5 MB |
|
|
~Get Your Files Here !/4. Configuring and Managing Windows Device Encryption.mp4 |
94.9 MB |
|
~Get Your Files Here !/4. Configuring and Managing Windows Device Encryption.srt |
23.6 KB |
|
~Get Your Files Here !/5. Configuring and Managing Non-Windows Device Encryption.mp4 |
52.0 MB |
|
~Get Your Files Here !/5. Configuring and Managing Non-Windows Device Encryption.srt |
12.8 KB |
|
Showing first 4 matched files of 18 total files |
|
|
[FreeCourseSite.com] Udemy - HashiCorp Certified Vault Operations Professional 2022 |
|
8.8 GB |
|
|
|
128.6 MB |
|
|
23.0 KB |
|
|
70.6 MB |
|
|
11.7 KB |
|
|
0.3 KB |
|
Showing first 5 matched files of 223 total files |
|
|
Martinez R. Encryption and Decryption Algorithms for Plain Text and Images 2023 |
|
10.4 MB |
|
|
/Martinez R. Encryption and Decryption Algorithms for Plain Text and Images 2023.pdf |
10.4 MB |
|
1 matched files |
|
|
[GigaCourse.Com] Udemy - The Complete 2023 Web Development Bootcamp |
|
27.1 GB |
|
|
37 - Authentication & Security/005 Level 2 - Database Encryption.mp4 |
99.1 MB |
|
37 - Authentication & Security/005 Level 2 - Database Encryption_en.srt |
20.9 KB |
|
Showing first 2 matched files of 1098 total files |
|
|
[FreeCourseSite.com] Udemy - React with Test Driven Development |
|
5.6 GB |
|
|
|
27.3 MB |
|
Showing first 1 matched files of 80 total files |
|
|
desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009 |
|
9.6 GB |
|
|
3. Identity Access Management & S3/7. S3 Security And Encryption.mp4 |
46.6 MB |
|
3. Identity Access Management & S3/7. S3 Security And Encryption.srt |
8.2 KB |
|
Showing first 2 matched files of 696 total files |
|
|
[FreeCourseSite.com] Udemy - MERN From Scratch 2023 eCommerce Platform |
|
5.0 GB |
|
|
07 - Backend Authentication/007 User Register Endpoint & Encryption.mp4 |
76.6 MB |
|
07 - Backend Authentication/007 User Register Endpoint & Encryption_en.srt |
13.9 KB |
|
Showing first 2 matched files of 193 total files |
|
|
|
1.7 GB |
||
|
|
15.7 MB |
|
|
15.5 MB |
|
|
18.9 MB |
|
|
18.8 MB |
|
Showing first 4 matched files of 18 total files |
|
|
|
9.6 MB |
||
|
GiliSoft USB Stick Encryption 11.7 incl keygen [CrackingPatching] |
|
9.8 MB |
|
|
|
9.6 MB |
|
Showing first 1 matched files of 5 total files |
|
Copyright © 2026 FileMood.com