FileMood

Showing results 1220 to 1239 of about 5000 for encryption

[ CourseBoat.com ] Exam MD-101 Managing Modern Desktops (Video), 2nd Edition

8.1 GB

~Get Your Files Here !/46-8.8 Manage enterprise-level disk encryption.en.srt

20.7 KB

~Get Your Files Here !/46-8.8 Manage enterprise-level disk encryption.mp4

225.0 MB

 

Showing first 2 matched files of 144 total files

[ DevCourseWeb.com ] Udemy - Certified Ethical Hacker (CEHv12) Practical hands on Labs

3.4 GB

~Get Your Files Here !/12. Cryptography/1. Disk Encryption Using Veracrypt.mp4

45.6 MB

~Get Your Files Here !/12. Cryptography/1.1 Disk Encryption using Veracrypt.pdf

544.3 KB

~Get Your Files Here !/12. Cryptography/2. File and Text Message Encryption using Cryptoforge.mp4

26.3 MB

~Get Your Files Here !/12. Cryptography/2.1 File and Text Encryption using Cryptoforge.pdf

487.7 KB

~Get Your Files Here !/12. Cryptography/3. File encryption using Advanced encryption package.mp4

28.9 MB

 

Showing first 5 matched files of 121 total files

[ TutPig.com ] Udemy - Information Security Fundamentals (Best Starting Point)

2.3 GB

~Get Your Files Here !/8. Encryption/1. What is Encryption.mp4

14.9 MB

~Get Your Files Here !/8. Encryption/1.1 8.1 What is encryption.pdf

711.7 KB

~Get Your Files Here !/8. Encryption/2. Types of Encryption.mp4

54.3 MB

~Get Your Files Here !/8. Encryption/2.1 8.2 Types of Encryption.pdf

301.7 KB

 

Showing first 4 matched files of 67 total files

[ FreeCourseWeb.com ] PluralSight - .NET 6 BCL Fundamentals

1.1 GB

~Get Your Files Here !/01/demos/m7/AsymmetricEncryption/AsymmetricEncryption.csproj

0.2 KB

~Get Your Files Here !/01/demos/m7/AsymmetricEncryption/Program.cs

1.5 KB

~Get Your Files Here !/01/demos/m7/AsymmetricEncryption/vscode/launch.json

1.1 KB

~Get Your Files Here !/01/demos/m7/AsymmetricEncryption/vscode/tasks.json

1.2 KB

~Get Your Files Here !/01/demos/m7/SymmetricEncryption/Program.cs

1.1 KB

 

Showing first 5 matched files of 1229 total files

[GigaCourse.Com] Udemy - The Complete 2023 Web Development Bootcamp

43.5 GB

38 - Authentication Security/288 - Level 2 Database Encryption English.srt

21.5 KB

38 - Authentication Security/288 - Level 2 Database Encryption.mp4

169.7 MB

 

Showing first 2 matched files of 957 total files

Xia Q. Attribute-based Encryption (ABE). Foundations and Applications...2023

5.2 MB

/Xia Q. Attribute-based Encryption (ABE). Foundations and Applications...2023.pdf

5.2 MB

 

1 matched files

CyCon

28.6 GB

CyCon NATO/CyCon 2016/Anonymity, Privacy, Encryption.mp4

175.9 MB

 

Showing first 1 matched files of 540 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

3. Domain 2 Storage/8. S3 Encryption.mp4

44.1 MB

3. Domain 2 Storage/8. S3 Encryption.srt

12.8 KB

8. Domain 6 Security/1. Encryption 101.mp4

33.7 MB

8. Domain 6 Security/1. Encryption 101.srt

10.0 KB

8. Domain 6 Security/2. S3 Encryption (Reminder).mp4

44.1 MB

 

Showing first 5 matched files of 612 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

03 - SDLC Automation (Domain 1)/032 CodePipeline - Artifacts, Encryption and S3.mkv

35.7 MB

 

Showing first 1 matched files of 242 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

03 - SDLC Automation (Domain 1)/032 CodePipeline - Artifacts, Encryption and S3.mkv

35.7 MB

 

Showing first 1 matched files of 234 total files

[ CourseHulu.com ] Cloud Academy - Device and Application Protection in Microsoft 365

530.5 MB

~Get Your Files Here !/4. Configuring and Managing Windows Device Encryption.mp4

94.9 MB

~Get Your Files Here !/4. Configuring and Managing Windows Device Encryption.srt

23.6 KB

~Get Your Files Here !/5. Configuring and Managing Non-Windows Device Encryption.mp4

52.0 MB

~Get Your Files Here !/5. Configuring and Managing Non-Windows Device Encryption.srt

12.8 KB

 

Showing first 4 matched files of 18 total files

[FreeCourseSite.com] Udemy - HashiCorp Certified Vault Operations Professional 2022

8.8 GB

2. Create a working Vault server configuration given a scenario/42. Rekey Vault and Rotate Encryption Keys.mp4

128.6 MB

2. Create a working Vault server configuration given a scenario/42. Rekey Vault and Rotate Encryption Keys.srt

23.0 KB

2. Create a working Vault server configuration given a scenario/43. Demo - Rekey Vault and Rotate Encryption Keys.mp4

70.6 MB

2. Create a working Vault server configuration given a scenario/43. Demo - Rekey Vault and Rotate Encryption Keys.srt

11.7 KB

2. Create a working Vault server configuration given a scenario/44. Hands-On Lab - Rekey Vault and Rotate Encryption Keys.html

0.3 KB

 

Showing first 5 matched files of 223 total files

Martinez R. Encryption and Decryption Algorithms for Plain Text and Images 2023

10.4 MB

/Martinez R. Encryption and Decryption Algorithms for Plain Text and Images 2023.pdf

10.4 MB

 

1 matched files

[GigaCourse.Com] Udemy - The Complete 2023 Web Development Bootcamp

27.1 GB

37 - Authentication & Security/005 Level 2 - Database Encryption.mp4

99.1 MB

37 - Authentication & Security/005 Level 2 - Database Encryption_en.srt

20.9 KB

 

Showing first 2 matched files of 1098 total files

[FreeCourseSite.com] Udemy - React with Test Driven Development

5.6 GB

8. Client State Management/12. LocalStorage Encryption.mp4

27.3 MB

 

Showing first 1 matched files of 80 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

3. Identity Access Management & S3/7. S3 Security And Encryption.mp4

46.6 MB

3. Identity Access Management & S3/7. S3 Security And Encryption.srt

8.2 KB

 

Showing first 2 matched files of 696 total files

[FreeCourseSite.com] Udemy - MERN From Scratch 2023 eCommerce Platform

5.0 GB

07 - Backend Authentication/007 User Register Endpoint & Encryption.mp4

76.6 MB

07 - Backend Authentication/007 User Register Endpoint & Encryption_en.srt

13.9 KB

 

Showing first 2 matched files of 193 total files

tens-3.0.3.1-public

1.7 GB

/EncryptionWizard-Public-3.5.10.zip

15.7 MB

EncryptionWizard-Public-3.5.9.zip

15.5 MB

EncryptionWizard-Unified-3.5.10-FIPS.zip

18.9 MB

EncryptionWizard-Unified-3.5.9-FIPS.zip

18.8 MB

 

Showing first 4 matched files of 18 total files

GiliSoft USB Stick Encryption

9.6 MB

GiliSoft USB Stick Encryption 11.7 incl keygen [CrackingPatching]

9.8 MB

usb-stick-encryption.exe

9.6 MB

 

Showing first 1 matched files of 5 total files


Copyright © 2026 FileMood.com