|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
|
23.6 MB |
|
|
8.7 KB |
|
|
44.9 MB |
|
|
9.7 KB |
|
|
35.3 MB |
|
Showing first 5 matched files of 612 total files |
|
|
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/009 CodeCommit - & AWS Lambda.mkv |
63.7 MB |
|
03 - SDLC Automation (Domain 1)/028 CodeDeploy - Deploy to AWS Lambda.mkv |
70.7 MB |
|
03 - SDLC Automation (Domain 1)/037 CodePipeline - Custom Action Jobs with AWS Lambda.mkv |
104.1 MB |
|
|
115.2 MB |
|
04 - Configuration Management and Infrastructure as Code (Domain 2)/045 Lambda - Overview.mkv |
99.4 MB |
|
Showing first 5 matched files of 242 total files |
|
|
Java.COMPLETO.2020.Programação.Orientada.a.Objetos.+Projetos |
|
30.8 GB |
|
|
|
36.1 MB |
|
20. Programação funcional e expressões lambda/2. Material de apoio do capítulo.html |
0.4 KB |
|
|
201.5 KB |
|
20. Programação funcional e expressões lambda/2.2 15-programacao-funcional-expressoes-lambda.pdf.pdf |
204.4 KB |
|
20. Programação funcional e expressões lambda/3. Uma experiência com Comparator.mp4 |
213.6 MB |
|
Showing first 5 matched files of 403 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/009 CodeCommit - & AWS Lambda.mkv |
63.7 MB |
|
03 - SDLC Automation (Domain 1)/028 CodeDeploy - Deploy to AWS Lambda.mkv |
70.7 MB |
|
03 - SDLC Automation (Domain 1)/037 CodePipeline - Custom Action Jobs with AWS Lambda.mkv |
104.1 MB |
|
|
115.2 MB |
|
04 - Configuration Management and Infrastructure as Code (Domain 2)/045 Lambda - Overview.mkv |
99.4 MB |
|
Showing first 5 matched files of 234 total files |
|
|
[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass |
|
6.3 GB |
|
|
|
0.1 KB |
|
|
0.1 KB |
|
|
0.1 KB |
|
|
0.1 KB |
|
|
0.1 KB |
|
Showing first 5 matched files of 8394 total files |
|
|
|
4.1 GB |
||
|
|
9.4 MB |
|
Showing first 1 matched files of 370 total files |
|
|
|
5.8 GB |
||
|
[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass |
|
43.5 GB |
|
|
|
0.1 KB |
|
|
0.1 KB |
|
|
0.1 KB |
|
|
0.1 KB |
|
|
0.1 KB |
|
Showing first 5 matched files of 9110 total files |
|
|
Udemy, Abdul Bari - Learn C++ Programming - Beginner to Advance - Deep Dive in C++ (05.2020) |
|
31.4 GB |
|
|
|
137.0 MB |
|
|
51.4 MB |
|
|
10.2 KB |
|
|
7.7 KB |
|
Showing first 4 matched files of 828 total files |
|
|
|
1.7 GB |
||
|
Doug.Hoyte.-.Let.Over.Lambda-AMiGOS/Doug.Hoyte.-.Let.Over.Lambda-AMiGOS.nfo |
5.5 KB |
|
Doug.Hoyte.-.Let.Over.Lambda-AMiGOS/Doug.Hoyte.-.Let.Over.Lambda-AMiGOS.djvu |
12.0 MB |
|
Showing first 2 matched files of 231 total files |
|
|
|
76.9 GB |
||
|
|
127.4 MB |
|
Showing first 1 matched files of 638 total files |
|
|
|
4.5 GB |
||
|
|
48.1 MB |
|
|
18.4 KB |
|
|
2.0 KB |
|
|
135.6 KB |
|
|
10.0 KB |
|
Showing first 5 matched files of 2100 total files |
|
|
desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009 |
|
9.6 GB |
|
|
|
116.9 MB |
|
|
20.6 KB |
|
Showing first 2 matched files of 696 total files |
|
|
|
8.2 GB |
||
|
/1999 VA - Deejay Top 4ty Future Dance Classics Part One/13. Lambda - Hold On Tight.flac |
37.6 MB |
|
|
27.4 MB |
|
Showing first 2 matched files of 339 total files |
|
|
|
35.7 GB |
||
|
VA_-_Dream_Dance_Vol_12-2CD-1999/1-14. Lambda - Hold On Tight 2000 (Future Breeze Radio Mix).mp3 |
7.4 MB |
|
VA_-_Dream_Dance_Vol_28-2CD-2003/1-01. Lambda - Hold On Tight (Kaylab & Reloop Radio Mix).mp3 |
8.8 MB |
|
Showing first 2 matched files of 4212 total files |
|
|
|
6.2 GB |
||
|
|
3.8 GB |
||
|
|
579.1 MB |
|
|
291.6 MB |
|
Showing first 2 matched files of 30 total files |
|
|
|
45.8 MB |
||
|
|
385.3 KB |
|
|
192.9 KB |
|
Showing first 2 matched files of 104 total files |
|
|
[FreeCourseSite.com] Udemy - Beginning C++ Programming - From Beginner to Beyond |
|
12.7 GB |
|
|
|
9.6 MB |
|
|
3.3 KB |
|
|
99.3 MB |
|
|
36.0 KB |
|
21 - Lambda Expressions/003 Structure of a Lambda Expression.mp4 |
14.3 MB |
|
Showing first 5 matched files of 693 total files |
|
|
[FreeCourseSite.com] Udemy - Android Jetpack Compose The Comprehensive Bootcamp [2022] |
|
18.6 GB |
|
Copyright © 2026 FileMood.com