FileMood

Showing results 1320 to 1339 of about 5000 for lambda

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

4. Domain 3 Processing/2. What is AWS Lambda.mp4

23.6 MB

4. Domain 3 Processing/2. What is AWS Lambda.srt

8.7 KB

4. Domain 3 Processing/3. Lambda Integration - Part 1.mp4

44.9 MB

4. Domain 3 Processing/3. Lambda Integration - Part 1.srt

9.7 KB

4. Domain 3 Processing/4. Lambda Integration - Part 2.mp4

35.3 MB

 

Showing first 5 matched files of 612 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

03 - SDLC Automation (Domain 1)/009 CodeCommit - & AWS Lambda.mkv

63.7 MB

03 - SDLC Automation (Domain 1)/028 CodeDeploy - Deploy to AWS Lambda.mkv

70.7 MB

03 - SDLC Automation (Domain 1)/037 CodePipeline - Custom Action Jobs with AWS Lambda.mkv

104.1 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/026 CloudFormation - Deploying Lambda Functions.mkv

115.2 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/045 Lambda - Overview.mkv

99.4 MB

 

Showing first 5 matched files of 242 total files

Java.COMPLETO.2020.Programação.Orientada.a.Objetos.+Projetos

30.8 GB

20. Programação funcional e expressões lambda/1. Visão geral do capítulo Programação Funcional e Expressões Lambda.mp4

36.1 MB

20. Programação funcional e expressões lambda/2. Material de apoio do capítulo.html

0.4 KB

20. Programação funcional e expressões lambda/2.1 15-programacao-funcional-expressoes-lambda(espaco-para-anotacoes).pdf.pdf

201.5 KB

20. Programação funcional e expressões lambda/2.2 15-programacao-funcional-expressoes-lambda.pdf.pdf

204.4 KB

20. Programação funcional e expressões lambda/3. Uma experiência com Comparator.mp4

213.6 MB

 

Showing first 5 matched files of 403 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

03 - SDLC Automation (Domain 1)/009 CodeCommit - & AWS Lambda.mkv

63.7 MB

03 - SDLC Automation (Domain 1)/028 CodeDeploy - Deploy to AWS Lambda.mkv

70.7 MB

03 - SDLC Automation (Domain 1)/037 CodePipeline - Custom Action Jobs with AWS Lambda.mkv

104.1 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/026 CloudFormation - Deploying Lambda Functions.mkv

115.2 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/045 Lambda - Overview.mkv

99.4 MB

 

Showing first 5 matched files of 234 total files

[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass

6.3 GB

12 - Generators Comprehensions and the timeit module/412 - Source Code Generators Comprehensions and Lambda Expressions Generators and Yield.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/413 - Source Code Generators Comprehensions and Lambda Expressions Next and Ranges.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/414 - Source Code Generators Comprehensions and Lambda Expressions Generator Examples.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/418 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/419 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions and SideEffects.txt

0.1 KB

 

Showing first 5 matched files of 8394 total files

[ DevCourseWeb.com ] Udemy - Python for Biologists

4.1 GB

~Get Your Files Here !/14. Creating python function Arranging and organizing codes in an effective format/13. The lambda as an alternative function in case of small code.mp4

9.4 MB

 

Showing first 1 matched files of 370 total files

[Fanbox] lambda(jpg+gif) (1340 pics).zip

5.8 GB

[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass

43.5 GB

12 - Generators Comprehensions and the timeit module/412 - Source Code Generators Comprehensions and Lambda Expressions Generators and Yield.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/413 - Source Code Generators Comprehensions and Lambda Expressions Next and Ranges.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/414 - Source Code Generators Comprehensions and Lambda Expressions Generator Examples.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/418 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/419 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions and SideEffects.txt

0.1 KB

 

Showing first 5 matched files of 9110 total files

Udemy, Abdul Bari - Learn C++ Programming - Beginner to Advance - Deep Dive in C++ (05.2020)

31.4 GB

24. C++ 11/3. Lambda Expressions.mp4

137.0 MB

24. C++ 11/4. Demo - Lambda Expressions.mp4

51.4 MB

24. C++ 11/4. Demo - Lambda Expressions.srt

10.2 KB

24. C++ 11/3. Lambda Expressions.srt

7.7 KB

 

Showing first 4 matched files of 828 total files

Lisp

1.7 GB

Doug.Hoyte.-.Let.Over.Lambda-AMiGOS/Doug.Hoyte.-.Let.Over.Lambda-AMiGOS.nfo

5.5 KB

Doug.Hoyte.-.Let.Over.Lambda-AMiGOS/Doug.Hoyte.-.Let.Over.Lambda-AMiGOS.djvu

12.0 MB

 

Showing first 2 matched files of 231 total files

Ignite 4.0 - Rocketseat

76.9 GB

Node/Chapter VI/02 - Serverless/01 - Serverless/04 - Fazendo o deploy utilizando lambda - Rocketseat[3].mp4

127.4 MB

 

Showing first 1 matched files of 638 total files

python-complete-beginner-to-expert-course-2021

4.5 GB

[TutsNode.com] - Python Complete Beginner to Expert Course 2021/10. Functions in Python/3. lambda Functions.mp4

48.1 MB

[TutsNode.com] - Python Complete Beginner to Expert Course 2021/10. Functions in Python/3. lambda Functions.srt

18.4 KB

[TutsNode.com] - Python Complete Beginner to Expert Course 2021/10. Functions in Python/3.1 lambda_function_challenges_solutions.py

2.0 KB

[TutsNode.com] - Python Complete Beginner to Expert Course 2021/10. Functions in Python/3.2 Lambda Functions Appendix.pdf

135.6 KB

[TutsNode.com] - Python Complete Beginner to Expert Course 2021/10. Functions in Python/3.2 Lambda Functions Appendix_chocr.html.gz

10.0 KB

 

Showing first 5 matched files of 2100 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

12. Serverless/1. Lambda Concepts.mp4

116.9 MB

12. Serverless/1. Lambda Concepts.srt

20.6 KB

 

Showing first 2 matched files of 696 total files

VA - Deejay Top 4ty Future Dance Classics

8.2 GB

/1999 VA - Deejay Top 4ty Future Dance Classics Part One/13. Lambda - Hold On Tight.flac

37.6 MB

2005 VA - Deejay Top 4ty Epsilon (2-CD)/CD-2/19. Lambda - Hold On Tight 2003 (Kaylab & Reeloop Radio Edit).flac

27.4 MB

 

Showing first 2 matched files of 339 total files

Dream Dance

35.7 GB

VA_-_Dream_Dance_Vol_12-2CD-1999/1-14. Lambda - Hold On Tight 2000 (Future Breeze Radio Mix).mp3

7.4 MB

VA_-_Dream_Dance_Vol_28-2CD-2003/1-01. Lambda - Hold On Tight (Kaylab & Reloop Radio Mix).mp3

8.8 MB

 

Showing first 2 matched files of 4212 total files

[Fanbox] lambda(jpg+gif) (1383 pics).zip

6.2 GB

out-of-the-unknown-series-2

3.8 GB

Out Of The Unknown S02E03 - Lambda 1 - 1966.mkv

579.1 MB

Out Of The Unknown S02E03 - Lambda 1 - 1966.mp4

291.6 MB

 

Showing first 2 matched files of 30 total files

Leinster, Murray

45.8 MB

Novels/Leinster, Murray - Checkpoint Lambda - 1966.fb2

385.3 KB

Novels/Leinster, Murray - Checkpoint Lambda - 2019.epub

192.9 KB

 

Showing first 2 matched files of 104 total files

[FreeCourseSite.com] Udemy - Beginning C++ Programming - From Beginner to Beyond

12.7 GB

21 - Lambda Expressions/001 Section Overview.mp4

9.6 MB

21 - Lambda Expressions/001 Section Overview_en.srt

3.3 KB

21 - Lambda Expressions/002 Motivation.mp4

99.3 MB

21 - Lambda Expressions/002 Motivation_en.srt

36.0 KB

21 - Lambda Expressions/003 Structure of a Lambda Expression.mp4

14.3 MB

 

Showing first 5 matched files of 693 total files

[FreeCourseSite.com] Udemy - Android Jetpack Compose The Comprehensive Bootcamp [2022]

18.6 GB

09 - Kotlin Fundamentals - Functions/008 Lambda Expressions - an Introduction.mp4

41.6 MB

09 - Kotlin Fundamentals - Functions/008 Lambda Expressions - an Introduction_en.srt

12.6 KB

09 - Kotlin Fundamentals - Functions/009 [CHALLENGE SOLUTION] - CatAge - To Lambda Expression.mp4

8.1 MB

09 - Kotlin Fundamentals - Functions/009 [CHALLENGE SOLUTION] - CatAge - To Lambda Expression_en.srt

2.0 KB

09 - Kotlin Fundamentals - Functions/010 Using the it Lambda Keyword.mp4

8.3 MB

 

Showing first 5 matched files of 566 total files


Copyright © 2026 FileMood.com