|
[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [New Exam] |
2/0 |
14.8 GB |
|
|
/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.mp4 |
34.5 MB |
|
/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.vtt |
16.5 KB |
|
/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.mp4 |
12.8 MB |
|
/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.vtt |
5.6 KB |
|
/21. AWS Services/3. AWS Services - 1-3) Elasticache for Memcached.mp4 |
16.0 MB |
|
Showing first 5 matched files of 790 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023 |
0/2 |
14.7 GB |
|
|
|
9.1 KB |
|
/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache.mp4 |
40.5 MB |
|
Showing first 2 matched files of 437 total files |
|
|
[FreeCoursesOnline.Me] SkillShare - AWS Certified Cloud Practitioner 2020 |
0/2 |
2.7 GB |
|
|
|
14.8 MB |
|
Showing first 1 matched files of 73 total files |
|
|
LinuxAcademy - AWS Certified Solutions Architect Professional Level |
1/1 |
5.2 GB |
|
|
|
113.7 MB |
|
|
54.3 MB |
|
|
71.4 MB |
|
Showing first 3 matched files of 83 total files |
|
|
[FreeCourseSite.com] Udemy - Docker and Kubernetes The Complete Guide |
1/0 |
14.1 GB |
|
|
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt |
6.5 KB |
|
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4 |
27.3 MB |
|
Showing first 2 matched files of 666 total files |
|
|
Pluralsight - AWS Certified SysOps Admin - Associate 2023 by Faye Ellis |
1/0 |
3.7 GB |
|
|
/06. Reliability and Business Continuity/07. Using AWS ElastiCache.mp4 |
14.9 MB |
|
/06. Reliability and Business Continuity/07. Using AWS ElastiCache.srt |
9.6 KB |
|
Showing first 2 matched files of 382 total files |
|
|
0/1 |
163.2 GB |
||
|
/Amazom/AWS Certified Solutions Architect - Associate/10.1 - Amazon ElastiCache.mp4 |
109.9 MB |
|
Showing first 1 matched files of 865 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02 |
1/0 |
4.4 GB |
|
|
|
14.6 MB |
|
|
6.9 KB |
|
|
10.5 MB |
|
/12 - Databases and Analytics/010 Scaling ElastiCache_en.srt |
4.8 KB |
|
/12 - Databases and Analytics/011 [HOL] Create ElastiCache Cluster.mp4 |
37.4 MB |
|
Showing first 5 matched files of 411 total files |
|
|
0/1 |
9.2 GB |
||
|
|
69.9 MB |
|
Showing first 1 matched files of 237 total files |
|
|
[FreeCoursesOnline.Me] PacktPub - AWS Certified Cloud Practitioner_ Essentials Course 2020 [Video] |
0/1 |
1.9 GB |
|
|
|
12.8 MB |
|
/11 - Serverless computing/62 - Elasticache and Redshift.mp4 |
21.8 MB |
|
Showing first 2 matched files of 76 total files |
|
|
[FreeCoursesOnline.Me] A Cloud Guru - AWS Certified SysOps Administrator - Associate 2020 |
1/0 |
4.8 GB |
|
|
|
14.1 KB |
|
|
24.1 MB |
|
|
27.4 MB |
|
Showing first 3 matched files of 169 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified Developer - Associate 2020 |
0/1 |
8.2 GB |
|
|
|
65.9 MB |
|
|
10.3 KB |
|
|
83.4 MB |
|
|
11.9 KB |
|
Showing first 4 matched files of 359 total files |
|
|
[Tutorialsplanet.NET] Udemy - AWS Certified Developer - Associate 2020 |
0/1 |
8.4 GB |
|
|
|
65.8 MB |
|
|
9.2 KB |
|
|
83.4 MB |
|
|
10.5 KB |
|
Showing first 4 matched files of 351 total files |
|
|
|
2.9 GB |
||
|
/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4 |
35.1 MB |
|
Showing first 1 matched files of 92 total files |
|
|
|
14.1 GB |
||
|
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt |
6.5 KB |
|
/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4 |
27.3 MB |
|
Showing first 2 matched files of 662 total files |
|
|
|
15.8 GB |
||
|
|
70.6 MB |
|
|
45.3 MB |
|
Showing first 2 matched files of 244 total files |
|
|
PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program |
|
7.1 GB |
|
|
|
134.7 MB |
|
Showing first 1 matched files of 72 total files |
|
|
|
2.0 GB |
||
|
/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4 |
47.0 MB |
|
Showing first 1 matched files of 120 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
|
11.7 MB |
|
|
3.8 KB |
|
Showing first 2 matched files of 612 total files |
|
|
desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009 |
|
9.6 GB |
|
|
|
23.2 MB |
|
|
5.2 KB |
|
Showing first 2 matched files of 696 total files |
|
Copyright © 2025 FileMood.com