|
0/1 |
4.2 GB |
||
|
/CD18 - Police, Fire engines/CD18/63. Firehose Unreeling.wav |
8.3 MB |
|
/CD18 - Police, Fire engines/CD18/64. Firehose Being Reeled In #1.wav |
7.1 MB |
|
/CD18 - Police, Fire engines/CD18/65. Firehose Being Reeled In #2.wav |
13.4 MB |
|
/CD18 - Police, Fire engines/CD18/67. Firehose Nozzle - On, Off #1.wav |
3.2 MB |
|
/CD18 - Police, Fire engines/CD18/68. Firehose Nozzle - On, Off #2.wav |
3.7 MB |
|
Showing first 5 matched files of 616 total files |
|
|
0/1 |
114.0 MB |
||
|
|
260.2 KB |
|
|
243.7 KB |
|
Showing first 2 matched files of 884 total files |
|
|
|
891.1 MB |
||
|
|
7.9 MB |
|
Showing first 1 matched files of 100 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
/2. Domain 1 Collection/10. [Exercise] Kinesis Firehose, Part 2.mp4 |
74.2 MB |
|
/2. Domain 1 Collection/10. [Exercise] Kinesis Firehose, Part 2.srt |
9.6 KB |
|
/2. Domain 1 Collection/11. [Exercise] Kinesis Firehose, Part 3.mp4 |
77.7 MB |
|
/2. Domain 1 Collection/11. [Exercise] Kinesis Firehose, Part 3.srt |
15.1 KB |
|
|
47.4 MB |
|
Showing first 5 matched files of 612 total files |
|
|
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
/05 - Monitoring and Logging (Domain 3)/006 Kinesis - Data Firehose & Analytics Overview.mkv |
8.8 MB |
|
/05 - Monitoring and Logging (Domain 3)/007 Kinesis - Data Firehose Hands On.mkv |
48.3 MB |
|
|
136.4 MB |
|
Showing first 3 matched files of 242 total files |
|
|
|
5.3 GB |
||
|
|
47.4 MB |
|
/02 Domain 1 Collection/014 [Exercise] Kinesis Firehose Part 1.mp4 |
48.9 MB |
|
/02 Domain 1 Collection/015 [Exercise] Kinesis Firehose Part 2.mp4 |
74.2 MB |
|
/02 Domain 1 Collection/016 [Exercise] Kinesis Firehose Part 3.mp4 |
77.7 MB |
|
Showing first 4 matched files of 138 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam] |
|
25.4 GB |
|
|
|
27.8 MB |
|
|
15.1 KB |
|
|
111.5 MB |
|
|
21.9 KB |
|
Showing first 4 matched files of 1023 total files |
|
|
|
11.5 GB |
||
|
/12 Analytics/197 Create Kinesis Data and Firehose Streams.mp4 |
33.3 MB |
|
Showing first 1 matched files of 275 total files |
|
|
|
463.5 MB |
||
|
|
4.5 MB |
|
Showing first 1 matched files of 148 total files |
|
|
|
240.0 MB |
||
|
|
0.9 KB |
|
|
1.0 KB |
|
Showing first 2 matched files of 18 total files |
|
|
riva_global_images_V11.0.2.0.OCKMIXM_20191106.0000.00_8.1_global_605da3d46d |
|
3.7 GB |
|
|
|
379.0 KB |
|
Showing first 1 matched files of 41 total files |
|
|
fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England |
|
240.4 MB |
|
|
|
1.0 KB |
|
/fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England.md5 |
1.5 KB |
|
|
7.8 MB |
|
|
8.6 MB |
|
|
8.7 MB |
|
Showing first 5 matched files of 19 total files |
|
|
fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England |
|
240.4 MB |
|
|
|
1.0 KB |
|
/fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England.md5 |
1.5 KB |
|
/fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England.torrent |
20.1 KB |
|
|
7.8 MB |
|
|
8.6 MB |
|
Showing first 5 matched files of 20 total files |
|
|
|
3.5 GB |
||
|
/aws-solutions-architect-professional/10 Data Engineering/062 Kinesis Data Firehose.mp4 |
25.1 MB |
|
Showing first 1 matched files of 134 total files |
|
|
|
23.8 GB |
||
|
|
82.3 MB |
|
Showing first 1 matched files of 197 total files |
|
|
|
8.4 GB |
||
|
|
28.4 MB |
|
Showing first 1 matched files of 233 total files |
|
|
|
984.9 MB |
||
|
|
6.8 MB |
|
Showing first 1 matched files of 99 total files |
|
|
|
16.8 GB |
||
|
|
557.1 MB |
|
Showing first 1 matched files of 37 total files |
|
|
|
1.0 GB |
||
|
|
6.8 MB |
|
Showing first 1 matched files of 101 total files |
|
|
VA - 100 Greatest Alternative 90s (2020) Mp3 320kbps [PMEDIA] ⭐️ |
|
1.0 GB |
|
|
|
6.8 MB |
|
Showing first 1 matched files of 108 total files |
|
Copyright © 2024 FileMood.com
