1/1 |
7.4 GB |
||
/9. Chapter 8 - Building an AppSync backend -part 3-/9.2. Kinesis Firehose 101.mp4 |
39.0 MB |
/9. Chapter 8 - Building an AppSync backend -part 3-/9.3. Configure Kinesis Firehose.mp4 |
47.7 MB |
|
17.4 MB |
Showing first 3 matched files of 202 total files |
4/1 |
12.3 GB |
||
|
6.6 KB |
|
2.8 KB |
|
25.7 MB |
|
9.3 MB |
Showing first 4 matched files of 617 total files |
[ DevCourseWeb.com ] Udemy - [AWS Projets ]- 7 AWS Projects to Supercharge Your Portfolio |
4/0 |
2.0 GB |
|
|
0.2 KB |
|
0.2 KB |
|
0.2 KB |
Showing first 3 matched files of 108 total files |
[FreeCourseSite.com] Udemy - AWS Certified Machine Learning Specialty 2023 - Hands On! |
3/0 |
2.9 GB |
|
/02 - Data Engineering/008 Kinesis Data Streams & Kinesis Data Firehose.mp4 |
24.3 MB |
/02 - Data Engineering/008 Kinesis Data Streams & Kinesis Data Firehose_en.vtt |
23.9 KB |
/02 - Data Engineering/009 Lab 1.1 - Kinesis Data Firehose.mp4 |
42.2 MB |
/02 - Data Engineering/009 Lab 1.1 - Kinesis Data Firehose_en.vtt |
11.3 KB |
Showing first 4 matched files of 264 total files |
|
891.1 MB |
||
|
7.9 MB |
Showing first 1 matched files of 100 total files |
[ DevCourseWeb.com ] AWS Certified Solutions Architect Associate WARP 9 |
0/1 |
1.5 GB |
|
/~Get Your Files Here !/13 - 6 Big Data/006 KINESIS FIREHOSE.mp4 |
4.7 MB |
/~Get Your Files Here !/13 - 6 Big Data/006 KINESIS FIREHOSE_en.srt |
1.6 KB |
Showing first 2 matched files of 220 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/2. Domain 1 Collection/10. [Exercise] Kinesis Firehose, Part 2.mp4 |
74.2 MB |
/2. Domain 1 Collection/10. [Exercise] Kinesis Firehose, Part 2.srt |
9.6 KB |
/2. Domain 1 Collection/11. [Exercise] Kinesis Firehose, Part 3.mp4 |
77.7 MB |
/2. Domain 1 Collection/11. [Exercise] Kinesis Firehose, Part 3.srt |
15.1 KB |
|
47.4 MB |
Showing first 5 matched files of 612 total files |
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
/05 - Monitoring and Logging (Domain 3)/006 Kinesis - Data Firehose & Analytics Overview.mkv |
8.8 MB |
/05 - Monitoring and Logging (Domain 3)/007 Kinesis - Data Firehose Hands On.mkv |
48.3 MB |
|
136.4 MB |
Showing first 3 matched files of 242 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
1/0 |
10.3 GB |
|
/05 - Monitoring and Logging (Domain 3)/006 Kinesis - Data Firehose & Analytics Overview.mkv |
8.8 MB |
/05 - Monitoring and Logging (Domain 3)/007 Kinesis - Data Firehose Hands On.mkv |
48.3 MB |
|
136.4 MB |
Showing first 3 matched files of 234 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2023 - DOP-C02 |
13/0 |
10.5 GB |
|
/05 - [DOP-C02] Domain 3 Resilient Cloud Solutions/031 [SAADVA] Kinesis Data Firehose - Overview.mp4 |
10.9 MB |
|
9.2 KB |
/05 - [DOP-C02] Domain 3 Resilient Cloud Solutions/032 [SAADVA] Kinesis Data Firehose - Hands On.mp4 |
31.7 MB |
|
17.4 KB |
|
6.1 MB |
Showing first 5 matched files of 918 total files |
|
5.3 GB |
||
|
47.4 MB |
/02 Domain 1 Collection/014 [Exercise] Kinesis Firehose Part 1.mp4 |
48.9 MB |
/02 Domain 1 Collection/015 [Exercise] Kinesis Firehose Part 2.mp4 |
74.2 MB |
/02 Domain 1 Collection/016 [Exercise] Kinesis Firehose Part 3.mp4 |
77.7 MB |
Showing first 4 matched files of 138 total files |
[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam] |
|
25.4 GB |
|
|
27.8 MB |
|
15.1 KB |
|
111.5 MB |
|
21.9 KB |
Showing first 4 matched files of 1023 total files |
|
11.5 GB |
||
/12 Analytics/197 Create Kinesis Data and Firehose Streams.mp4 |
33.3 MB |
Showing first 1 matched files of 275 total files |
|
463.5 MB |
||
|
4.5 MB |
Showing first 1 matched files of 148 total files |
|
240.0 MB |
||
|
0.9 KB |
|
1.0 KB |
Showing first 2 matched files of 18 total files |
riva_global_images_V11.0.2.0.OCKMIXM_20191106.0000.00_8.1_global_605da3d46d |
|
3.7 GB |
|
|
379.0 KB |
Showing first 1 matched files of 41 total files |
fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England |
|
240.4 MB |
|
|
1.0 KB |
/fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England.md5 |
1.5 KB |
|
7.8 MB |
|
8.6 MB |
|
8.7 MB |
Showing first 5 matched files of 19 total files |
fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England |
|
240.4 MB |
|
|
1.0 KB |
/fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England.md5 |
1.5 KB |
/fIREHOSE - 1987-06-08 The New Ardri Ballroom, Hulme, Manchester, England.torrent |
20.1 KB |
|
7.8 MB |
|
8.6 MB |
Showing first 5 matched files of 20 total files |
|
3.5 GB |
||
/aws-solutions-architect-professional/10 Data Engineering/062 Kinesis Data Firehose.mp4 |
25.1 MB |
Showing first 1 matched files of 134 total files |
|
23.8 GB |
||
|
82.3 MB |
Showing first 1 matched files of 197 total files |
Copyright © 2024 FileMood.com