FileMood

Showing results 20 to 39 of about 1562 for gemak

CardStudio.2.5.5.0

1/0

159.4 MB

/CardStudio.2.5.5.0/Crack/PrintStudio/BadgeMaker.dll

486.9 KB

 

Showing first 1 matched files of 6 total files

GetFreeCourses.Co-Udemy-2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT

2/1

20.6 GB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message.mp4

6.5 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message_en.srt

1.6 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 AWS-Essentials-Starter-Pack-Part-3.zip

11.8 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 Please Download Today's Materials.html

0.2 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/003 Intro to SageMaker.mp4

179.2 MB

 

Showing first 5 matched files of 967 total files

60 Assorted Magazines Collection PDF October 3 2022 Set 9

0/1

2.7 GB

/Covers/Passagemaker October 2022.jpg

160.7 KB

/Magazines/Passagemaker October 2022.pdf

101.9 MB

 

Showing first 2 matched files of 122 total files

AWS

5/4

2.1 GB

/1789349796 Mastering Machine Learning on AWS (SageMaker, Apache Spark, TensorFlow) [Mengle & Gurmendez 2019] {BF53F68F}.pdf

20.4 MB

 

Showing first 1 matched files of 125 total files

adobe-pagemaker-7.0-serial

135.2 MB

/Adobe pagemaker 7.0 + Serial.zip

135.2 MB

/adobe-pagemaker-7.0-serial_meta.sqlite

11.3 KB

/adobe-pagemaker-7.0-serial_meta.xml

0.9 KB

 

3 matched files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/5. Machine Learning AWS Certified Big Data exam only!/10. Quiz Amazon Machine Learning and SageMaker.html

0.1 KB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.mp4

52.9 MB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.srt

14.0 KB

 

Showing first 3 matched files of 612 total files

WebPageMakerV3Templates

16.8 MB

/WebPageMakerV3Templates_meta.sqlite

9.2 KB

/WebPageMakerV3Templates_meta.xml

1.0 KB

 

Showing first 2 matched files of 3 total files

Varietys.Power.of.Women.The.Changemakers.2022.720p.WEB.h264-BAE[rarbg]

803.2 MB

/Varietys.Power.of.Women.The.Changemakers.2022.720p.WEB.h264-BAE.mkv

803.2 MB

/varietys.power.of.women.the.changemakers.2022.720p.web.h264-bae.nfo

0.1 KB

 

Showing first 2 matched files of 4 total files

[ DevCourseWeb.com ] Udemy - Aws Certified Cloud Practitioner + Practice Exams (2022)

0/1

3.5 GB

/~Get Your Files Here !/22 - Other AWS Services/218 - Amazon sagemakermp4.mp4

6.9 MB

 

Showing first 1 matched files of 245 total files

Adobe InDesign 2022 v17.0.0.96 (x64) Multilingual Pre-Activated - #FreeCracksDownload#

745.5 MB

/Language Pack/cs_CZ/Presets/InDesign Shortcut Sets/cs_CZ/Shortcuts for PageMaker 7.0.indk

88.5 KB

/Language Pack/da_DK/Presets/InDesign Shortcut Sets/da_DK/Shortcuts for PageMaker 7.0.indk

88.5 KB

/Language Pack/de_DE/Presets/InDesign Shortcut Sets/de_DE/Shortcuts for PageMaker 7.0.indk

88.5 KB

/Language Pack/en_GB/Presets/InDesign Shortcut Sets/en_GB/Shortcuts for PageMaker 7.0.indk

88.5 KB

/Language Pack/en_US/Presets/InDesign Shortcut Sets/en_US/Shortcuts for PageMaker 7.0.indk

88.5 KB

 

Showing first 5 matched files of 554 total files

adobe-page-maker-7.7z

119.7 MB

/AdobePageMaker7.7z

119.6 MB

/PageMaker.jpg

42.0 KB

/PageMaker_thumb.jpg

8.2 KB

 

Showing first 3 matched files of 6 total files

usenet-comp

2/0

34.6 GB

/comp.graphics.apps.pagemaker.mbox.zip

19.7 MB

 

Showing first 1 matched files of 2416 total files

[GigaCourse.Com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp

7.1 GB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.mp4

36.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.srt

2.1 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.mp4

11.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.srt

2.7 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/11. Task 7. Final Project Overview.mp4

26.0 MB

 

Showing first 5 matched files of 239 total files

非典型女性.时代开拓者.Unladylike.The.Changemakers.2020.1080p.H264-NEW字幕组.特效版.mp4

0/2

1.9 GB

UD1

5.3 GB

/04 Domain 3 Processing/075 SageMaker.mp4

52.9 MB

 

Showing first 1 matched files of 138 total files

Unladylike.The.Changemakers.2020.1080p.AMZN.WEBRip.DDP2.0.x264-MRCS

2.0 GB

/Unladylike.The.Changemakers.2020.1080p.AMZN.WEB-DL.DDP2.0.H.264-MRCS.mkv

2.0 GB

 

Showing first 1 matched files of 2 total files

[UdemyCourseacom] Udemy - Adobe InDesign CC - Essentials Training Course

1.8 GB

/1. Introduction/4. What are the differences between InDesign and PageMaker, Illustrator, Photoshop,.mp4

90.5 MB

 

Showing first 1 matched files of 139 total files

60 Assorted Magazines PDF April 14 2021 Pack 2

3.2 GB

/Covers/Passagemaker January 2021.jpg

1.2 MB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

Adobe Pagemaker 7.0 with Serial

14.2 MB

/Adobe Pagemaker 7.0 with Serial.exe

1.6 MB

 

Showing first 1 matched files of 5 total files

AMS Software Photo Collage Maker Pro 7.0_Fix

199.4 MB

/Crack/CollageMaker.exe

7.0 MB

/CollageMaker.exe

192.2 MB

 

Showing first 2 matched files of 4 total files


Copyright © 2024 FileMood.com