FileMood

Showing results 0 to 19 of about 129 for sagemaker

[Coursera] Applied Python Data Engineering Specialization - 3 course series

17/3

2.3 GB

/spark-hadoop-snowflake-data-engineering/04_dataops-and-operations-methodologies/01_getting-started-with-kaizen-methodology-for-data/01_06_getting-started-with-amazon-sagemaker-studio-lab_instructions.html

4.7 KB

/spark-hadoop-snowflake-data-engineering/04_dataops-and-operations-methodologies/01_getting-started-with-kaizen-methodology-for-data/01_07_walking-through-sagemaker-studio-lab.en.srt

31.9 KB

/spark-hadoop-snowflake-data-engineering/04_dataops-and-operations-methodologies/01_getting-started-with-kaizen-methodology-for-data/01_07_walking-through-sagemaker-studio-lab.en.txt

17.4 KB

/spark-hadoop-snowflake-data-engineering/04_dataops-and-operations-methodologies/01_getting-started-with-kaizen-methodology-for-data/01_07_walking-through-sagemaker-studio-lab.mp4

104.4 MB

 

Showing first 4 matched files of 650 total files

Linkedin - Build an AI Application with React and AWS SageMaker

14/4

196.5 MB

/1. Introduction/1. Build an AI application with React and SageMaker.mp4

4.2 MB

/2. Introduction and Setup/2. Introduction to SageMaker.mp4

3.1 MB

/2. Introduction and Setup/3. AWS SageMaker setup.mp4

4.5 MB

/3. Feature Engineering/1. Introduction to SageMaker Data Wrangler.mp4

17.9 MB

/6. Conclusion/1. Continue learning SageMaker.mp4

1.1 MB

 

Showing first 5 matched files of 19 total files

[ DevCourseWeb.com ] ZerotoMastery - AI Engineering Bootcamp - Build, Train and Deploy Models with AWS SageMaker

12/1

2.0 GB

/~Get Your Files Here !/01. AI Engineering Bootcamp Learn AWS SageMaker with Patrik Szepesi - Zer - 1920x1080 2055K.mp4

18.0 MB

/~Get Your Files Here !/06. Set Up AWS SageMaker Domain - Zer - 1920x1080 453K.mp4

6.8 MB

/~Get Your Files Here !/08. Setting Up SageMaker Environment - Zer - 1920x1080 416K.mp4

13.9 MB

/~Get Your Files Here !/09. SageMaker Studio and Pricing - Zer - 1920x1080 429K.mp4

29.8 MB

/~Get Your Files Here !/10. Setup SageMaker Server + PyTorch - Zer - 1920x1080 342K.mp4

16.6 MB

 

Showing first 5 matched files of 87 total files

[FreeCourseSite.com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp

0/4

7.1 GB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.mp4

36.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.srt

2.1 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.mp4

11.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.srt

2.7 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/11. Task 7. Final Project Overview.mp4

26.0 MB

 

Showing first 5 matched files of 238 total files

[ DevCourseWeb.com ] Coursera - Practical Data Science on the AWS Cloud Specialization

1/0

1.6 GB

/~Get Your Files Here !/automl-datasets-ml-models/02_week-2-data-bias-and-feature-importance/01_statistical-bias-and-feature-importance/06_detect-statistical-bias-with-amazon-sagemaker-clarify.en.srt

9.2 KB

/~Get Your Files Here !/automl-datasets-ml-models/02_week-2-data-bias-and-feature-importance/01_statistical-bias-and-feature-importance/06_detect-statistical-bias-with-amazon-sagemaker-clarify.en.txt

4.8 KB

/~Get Your Files Here !/automl-datasets-ml-models/02_week-2-data-bias-and-feature-importance/01_statistical-bias-and-feature-importance/06_detect-statistical-bias-with-amazon-sagemaker-clarify.mp4

12.7 MB

/~Get Your Files Here !/automl-datasets-ml-models/03_week-3-use-automated-machine-learning-to-train-a-text-classifier/01_automated-machine-learning/04_amazon-sagemaker-autopilot.en.srt

9.5 KB

/~Get Your Files Here !/automl-datasets-ml-models/03_week-3-use-automated-machine-learning-to-train-a-text-classifier/01_automated-machine-learning/04_amazon-sagemaker-autopilot.en.txt

5.1 KB

 

Showing first 5 matched files of 332 total files

[FreeCourseSite.com] Udemy - AWS Certified Machine Learning Specialty 2023 - Hands On!

1/2

2.9 GB

/03 - Exploratory Data Analysis/018 Amazon SageMaker Ground Truth and Label Generation.mp4

17.5 MB

/03 - Exploratory Data Analysis/018 Amazon SageMaker Ground Truth and Label Generation_en.vtt

12.2 KB

/05 - Modeling, Part 2 Amazon SageMaker/001 Introducing Amazon SageMaker.mp4

53.8 MB

/05 - Modeling, Part 2 Amazon SageMaker/001 Introducing Amazon SageMaker_en.vtt

13.0 KB

/05 - Modeling, Part 2 Amazon SageMaker/002 Linear Learner in SageMaker.mp4

11.6 MB

 

Showing first 5 matched files of 264 total files

Profissao.Analista.de.Dados.EBAC

2/1

17.9 GB

/Module 40 - Computação em Nuvem III Abertura/Aula 2 AWS SageMaker — EBAC LMS.ts

94.7 MB

 

Showing first 1 matched files of 419 total files

Data Engineering with Python and AWS Lambda

17/1

1.8 GB

/[TutsNode.org] - Data Engineering with Python and AWS Lambda/Lesson 13 Create Serverless Business Intelligence and AutoML/003. 13.3 Integrate Lambda with Sagemaker.mp4

24.3 MB

 

Showing first 1 matched files of 123 total files

[FreeCourseSite.com] Udemy - 2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT

2/0

20.6 GB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message.mp4

6.5 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message_en.srt

1.6 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 AWS-Essentials-Starter-Pack-Part-3.zip

11.8 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 Please Download Today's Materials.html

0.2 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/003 Intro to SageMaker.mp4

179.2 MB

 

Showing first 5 matched files of 969 total files

40 Assorted PDF Magazines Collection May 21 2023 [Set 2]

0/2

2.1 GB

/Covers/Passagemaker March 2023.jpg

346.0 KB

/Magazines/Passagemaker March 2023.pdf

53.0 MB

 

Showing first 2 matched files of 81 total files

GetFreeCourses.Co-Udemy-2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT

1/1

20.6 GB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message.mp4

6.5 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message_en.srt

1.6 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 AWS-Essentials-Starter-Pack-Part-3.zip

11.8 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 Please Download Today's Materials.html

0.2 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/003 Intro to SageMaker.mp4

179.2 MB

 

Showing first 5 matched files of 967 total files

60 Assorted Magazines Collection PDF October 3 2022 Set 9

0/1

2.7 GB

/Covers/Passagemaker October 2022.jpg

160.7 KB

/Magazines/Passagemaker October 2022.pdf

101.9 MB

 

Showing first 2 matched files of 122 total files

AWS

1/1

2.1 GB

/1789349796 Mastering Machine Learning on AWS (SageMaker, Apache Spark, TensorFlow) [Mengle & Gurmendez 2019] {BF53F68F}.pdf

20.4 MB

 

Showing first 1 matched files of 125 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/5. Machine Learning AWS Certified Big Data exam only!/10. Quiz Amazon Machine Learning and SageMaker.html

0.1 KB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.mp4

52.9 MB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.srt

14.0 KB

 

Showing first 3 matched files of 612 total files

[ DevCourseWeb.com ] Udemy - Aws Certified Cloud Practitioner + Practice Exams (2022)

3/1

3.5 GB

/~Get Your Files Here !/22 - Other AWS Services/218 - Amazon sagemakermp4.mp4

6.9 MB

 

Showing first 1 matched files of 245 total files

[GigaCourse.Com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp

7.1 GB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.mp4

36.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.srt

2.1 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.mp4

11.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.srt

2.7 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/11. Task 7. Final Project Overview.mp4

26.0 MB

 

Showing first 5 matched files of 239 total files

UD1

5.3 GB

/04 Domain 3 Processing/075 SageMaker.mp4

52.9 MB

 

Showing first 1 matched files of 138 total files

60 Assorted Magazines PDF April 14 2021 Pack 2

3.2 GB

/Covers/Passagemaker January 2021.jpg

1.2 MB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

40 Assorted Magazines PDF March 6 2021 Pack 3

2.7 GB

/Covers/PassageMaker March 2021.jpg

1.1 MB

/Magazines/PassageMaker March 2021.pdf

62.1 MB

 

Showing first 2 matched files of 80 total files

60 Assorted Magazines PDF February 25 2021 Pack 4

3.1 GB

/Covers/Passagemaker January 2021.jpg

1.2 MB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files


Copyright © 2024 FileMood.com