[Coursera] Applied Python Data Engineering Specialization - 3 course series |
17/3 |
2.3 GB |
|
|
4.7 KB |
|
31.9 KB |
|
17.4 KB |
|
104.4 MB |
Showing first 4 matched files of 650 total files |
Linkedin - Build an AI Application with React and AWS SageMaker |
14/4 |
196.5 MB |
|
/1. Introduction/1. Build an AI application with React and SageMaker.mp4 |
4.2 MB |
|
3.1 MB |
|
4.5 MB |
/3. Feature Engineering/1. Introduction to SageMaker Data Wrangler.mp4 |
17.9 MB |
|
1.1 MB |
Showing first 5 matched files of 19 total files |
12/1 |
2.0 GB |
||
|
18.0 MB |
/~Get Your Files Here !/06. Set Up AWS SageMaker Domain - Zer - 1920x1080 453K.mp4 |
6.8 MB |
/~Get Your Files Here !/08. Setting Up SageMaker Environment - Zer - 1920x1080 416K.mp4 |
13.9 MB |
/~Get Your Files Here !/09. SageMaker Studio and Pricing - Zer - 1920x1080 429K.mp4 |
29.8 MB |
/~Get Your Files Here !/10. Setup SageMaker Server + PyTorch - Zer - 1920x1080 342K.mp4 |
16.6 MB |
Showing first 5 matched files of 87 total files |
[FreeCourseSite.com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp |
0/4 |
7.1 GB |
|
[ DevCourseWeb.com ] Coursera - Practical Data Science on the AWS Cloud Specialization |
1/0 |
1.6 GB |
|
|
9.2 KB |
|
4.8 KB |
|
12.7 MB |
|
9.5 KB |
|
5.1 KB |
Showing first 5 matched files of 332 total files |
[FreeCourseSite.com] Udemy - AWS Certified Machine Learning Specialty 2023 - Hands On! |
1/2 |
2.9 GB |
|
2/1 |
17.9 GB |
||
/Module 40 - Computação em Nuvem III Abertura/Aula 2 AWS SageMaker — EBAC LMS.ts |
94.7 MB |
Showing first 1 matched files of 419 total files |
17/1 |
1.8 GB |
||
|
24.3 MB |
Showing first 1 matched files of 123 total files |
[FreeCourseSite.com] Udemy - 2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT |
2/0 |
20.6 GB |
|
/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message.mp4 |
6.5 MB |
/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message_en.srt |
1.6 KB |
|
11.8 MB |
|
0.2 KB |
/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/003 Intro to SageMaker.mp4 |
179.2 MB |
Showing first 5 matched files of 969 total files |
0/2 |
2.1 GB |
||
|
346.0 KB |
|
53.0 MB |
Showing first 2 matched files of 81 total files |
GetFreeCourses.Co-Udemy-2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT |
1/1 |
20.6 GB |
|
/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message.mp4 |
6.5 MB |
/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message_en.srt |
1.6 KB |
|
11.8 MB |
|
0.2 KB |
/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/003 Intro to SageMaker.mp4 |
179.2 MB |
Showing first 5 matched files of 967 total files |
0/1 |
2.7 GB |
||
|
160.7 KB |
|
101.9 MB |
Showing first 2 matched files of 122 total files |
1/1 |
2.1 GB |
||
|
20.4 MB |
Showing first 1 matched files of 125 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
0.1 KB |
/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.mp4 |
52.9 MB |
/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.srt |
14.0 KB |
Showing first 3 matched files of 612 total files |
[ DevCourseWeb.com ] Udemy - Aws Certified Cloud Practitioner + Practice Exams (2022) |
3/1 |
3.5 GB |
|
/~Get Your Files Here !/22 - Other AWS Services/218 - Amazon sagemakermp4.mp4 |
6.9 MB |
Showing first 1 matched files of 245 total files |
[GigaCourse.Com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp |
|
7.1 GB |
|
|
5.3 GB |
||
|
52.9 MB |
Showing first 1 matched files of 138 total files |
|
3.2 GB |
||
|
1.2 MB |
|
64.1 MB |
Showing first 2 matched files of 120 total files |
|
2.7 GB |
||
|
1.1 MB |
|
62.1 MB |
Showing first 2 matched files of 80 total files |
|
3.1 GB |
||
|
1.2 MB |
|
64.1 MB |
Showing first 2 matched files of 120 total files |
Copyright © 2024 FileMood.com