|
[GigaCourse.Com] Udemy - NodeJS – The Complete Guide (MVC, REST APIs, GraphQL, Deno) |
|
20.2 GB |
|
|
27 Understanding Websockets & Socket.io/007 Sharing the IO Instance Across Files.en.srt |
3.5 KB |
|
27 Understanding Websockets & Socket.io/007 Sharing the IO Instance Across Files.mp4 |
24.0 MB |
|
Showing first 2 matched files of 1532 total files |
|
|
|
3.9 GB |
||
|
~Get Your Files Here !/3. Terraform/13. Create DevOps instances using for_each in Terraform.mp4 |
80.2 MB |
|
~Get Your Files Here !/3. Terraform/5. Write 1st Terraform manifest file to create EC2 instance.mp4 |
40.7 MB |
|
Showing first 2 matched files of 93 total files |
|
|
|
97.0 GB |
||
|
|
0.7 KB |
|
Showing first 1 matched files of 693 total files |
|
|
[ DevCourseWeb.com ] Udemy - Database Administration with SQL Server 2019 |
|
3.4 GB |
|
|
~Get Your Files Here !/10. Lesson 6 - Instance Configuration.mp4 |
160.8 MB |
|
~Get Your Files Here !/10.1 Lesson 6 - Instance Configuration.pptx |
883.0 KB |
|
Showing first 2 matched files of 52 total files |
|
|
|
24.1 GB |
||
|
|
183.8 KB |
|
Showing first 1 matched files of 1077 total files |
|
|
|
2.3 GB |
||
|
|
2.2 MB |
|
|
4.6 MB |
|
|
5.5 MB |
|
|
14.0 MB |
|
|
15.6 MB |
|
Showing first 5 matched files of 318 total files |
|
|
|
21.4 GB |
||
|
Satisfactory Stable/Engine/Binaries/Win64/FactoryGame-InstancedSplines-Win64-Shipping.dll |
269.3 KB |
|
Satisfactory Stable/Engine/Binaries/Win64/FactoryGame-InstancedSplines-Win64-Shipping.pdb |
35.2 MB |
|
|
195.6 KB |
|
|
30.2 MB |
|
|
0.1 KB |
|
Showing first 5 matched files of 684 total files |
|
|
|
3.1 GB |
||
|
2021 U-Nam - Love in Motion (Future Love, Pt. 3) (2021) by pere1109/05 - Instance Girl.mp3 |
13.1 MB |
|
Showing first 1 matched files of 294 total files |
|
|
|
2.5 GB |
||
|
|
3.2 KB |
|
|
9.7 MB |
|
Showing first 2 matched files of 282 total files |
|
|
The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes |
|
95.5 GB |
|
|
content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws |
2.1 KB |
|
content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws |
5.3 KB |
|
Showing first 2 matched files of 2961 total files |
|
|
The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes |
|
95.5 GB |
|
|
content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws |
2.1 KB |
|
content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws |
5.3 KB |
|
Showing first 2 matched files of 2961 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
4. Domain 3 Processing/25. EMR Security and Instance Types.mp4 |
48.4 MB |
|
4. Domain 3 Processing/25. EMR Security and Instance Types.srt |
10.0 KB |
|
|
16.1 MB |
|
|
4.2 KB |
|
Showing first 4 matched files of 612 total files |
|
|
|
70.7 GB |
||
|
Engine/Binaries/ThirdParty/Python3/Win64/Lib/lib2to3/fixes/fix_isinstance.py |
1.7 KB |
|
Showing first 1 matched files of 3519 total files |
|
|
|
68.7 GB |
||
|
Engine/Binaries/ThirdParty/Python3/Win64/Lib/lib2to3/fixes/fix_isinstance.py |
1.7 KB |
|
Showing first 1 matched files of 3491 total files |
|
|
|
74.5 GB |
||
|
|
2.9 KB |
|
Showing first 1 matched files of 1818 total files |
|
|
|
59.9 GB |
||
|
game_info/data/content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws |
2.1 KB |
|
game_info/data/content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws |
5.3 KB |
|
Showing first 2 matched files of 3932 total files |
|
|
|
11.7 GB |
||
|
|
19.3 MB |
|
|
19.3 MB |
|
|
19.3 MB |
|
|
19.3 MB |
|
|
19.3 MB |
|
Showing first 5 matched files of 1645 total files |
|
|
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/027 CodeDeploy - On-Premise Instances Setup.mkv |
130.0 MB |
|
06 - Policies and Standards Automation (Domain 4)/021 EC2 Instance Compliance.mkv |
10.0 MB |
|
Showing first 2 matched files of 242 total files |
|
|
|
1.4 GB |
||
|
|
38.6 MB |
|
|
69.2 MB |
|
06-step_involved_in_creation_of_linux_instance_and_access_through_putty.mkv |
162.5 MB |
|
Showing first 3 matched files of 25 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/027 CodeDeploy - On-Premise Instances Setup.mkv |
130.0 MB |
|
06 - Policies and Standards Automation (Domain 4)/021 EC2 Instance Compliance.mkv |
10.0 MB |
|
Showing first 2 matched files of 234 total files |
|
Copyright © 2026 FileMood.com