FileMood

Showing results 2240 to 2259 of about 5000 for processing

Stranded Deep (2022)

2.3 GB

/Stranded Deep/Stranded_Deep_Data/Managed/Unity.Postprocessing.Runtime.dll

144.9 KB
 

Showing first 1 matched files of 215 total files

[ FreeCourseWeb.com ] Rabelway - Introduction to Houdini for FX (Week 2)

1.9 GB

/~Get Your Files Here !/22_post_processing.mp4

182.9 MB
 

Showing first 1 matched files of 26 total files

Risk of Rain 2

2.3 GB

/Risk of Rain 2_Data/Managed/Unity.Postprocessing.Runtime.dll

147.5 KB
 

Showing first 1 matched files of 1838 total files

starboundsourcecode

791.6 MB

/source/core/StarImageProcessing.cpp

22.2 KB

/source/core/StarImageProcessing.hpp

4.0 KB
 

Showing first 2 matched files of 635 total files

Stranded Deep

4.2 GB

/Stranded_Deep_Data/Managed/Unity.Postprocessing.Runtime.dll

144.9 KB
 

Showing first 1 matched files of 232 total files

usenet-sci

23.4 GB

/sci.image.processing.mbox.zip

54.3 MB
 

Showing first 1 matched files of 482 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/4. Domain 3 Processing/1. Section Introduction Processing.mp4

32.2 MB

/4. Domain 3 Processing/1. Section Introduction Processing.srt

2.3 KB

/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.mp4

44.3 MB

/4. Domain 3 Processing/10. Glue ETL Developer Endpoints, Running ETL Jobs with Bookmarks.srt

44.3 MB

/4. Domain 3 Processing/11. Glue Costs and Anti-Patterns.mp4

15.4 MB
 

Showing first 5 matched files of 612 total files

Hardspace Shipbreaker (2022)

4.0 GB

/Hardspace Shipbreaker/Shipbreaker_Data/Managed/Unity.Postprocessing.Runtime.dll

149.0 KB

/Hardspace Shipbreaker/Shipbreaker_Data/StreamingAssets/aa/StandaloneWindows64/rendering-postprocessing_assets_all_1e7bb33e54290d37d5b99b7853acce46.bundle

34.7 KB
 

Showing first 2 matched files of 753 total files

[ CourseBoat.com ] Udemy - Basics of Computer Science and Information Systems (BCSIS)

1.1 GB

/~Get Your Files Here !/4. Module 3 - Types of Information Systems (IS) and Application/3. BCSIS-Module3-V1-Types-of-InformationSystems-P3-TransactionProcessingSys-OfficeA.mp4

69.8 MB

/~Get Your Files Here !/4. Module 3 - Types of Information Systems (IS) and Application/3. BCSIS-Module3-V1-Types-of-InformationSystems-P3-TransactionProcessingSys-OfficeA.srt

7.3 KB
 

Showing first 2 matched files of 46 total files

BnS

70.7 GB

/Engine/Binaries/ThirdParty/Python3/Win64/DLLs/_multiprocessing.pyd

29.7 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/connection.py

32.1 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/context.py

11.3 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/connection.py

1.7 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/__init__.py

3.2 KB
 

Showing first 5 matched files of 3519 total files

Soulja - The Beginners Dropshipping Course (www.imarketing.courses)

1.2 GB

/06-6. Payment Processing Optimization.mp4

25.7 MB
 

Showing first 1 matched files of 9 total files

BnS

68.7 GB

/Engine/Binaries/ThirdParty/Python3/Win64/DLLs/_multiprocessing.pyd

29.7 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/connection.py

32.1 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/context.py

11.3 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/connection.py

1.7 KB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/multiprocessing/dummy/__init__.py

3.2 KB
 

Showing first 5 matched files of 3491 total files

junos-srxsme

74.5 GB

/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview.pdf

5.1 MB

/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_chocr.html.gz

13.9 MB

/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_djvu.txt

1.1 MB

/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_djvu.xml

13.9 MB

/JunOS SRX Documentation Set/JunOS-Docs-SRX/security-processing-overview_hocr.html

27.4 MB
 

Showing first 5 matched files of 1818 total files

[ FreeCryptoLearn.com ] Udemy - Export Finance, Priority Sector, Retail Loan and Documentation

1.9 GB

/~Get Your Files Here !/6 - Fair Practices Code on Lenders Liability/115 - Fair Practices Code for Loan Processing English.vtt

3.1 KB

/~Get Your Files Here !/6 - Fair Practices Code on Lenders Liability/115 - Fair Practices Code for Loan Processing.mp4

7.7 MB
 

Showing first 2 matched files of 244 total files

[ DevCourseWeb.com ] Udemy - Machine Learning In Healthcare - Practical Approach By Orange

922.8 MB

/~Get Your Files Here !/3 - Project 1 Diabetes Prediction using Machine Learning/8 - Data Preprocessing Gain Ratio.mp4

54.7 MB
 

Showing first 1 matched files of 15 total files

Craftopia

23.1 GB

/Craftopia_Data/Managed/Unity.Postprocessing.Runtime.dll

149.5 KB
 

Showing first 1 matched files of 2001 total files

HitPaw Photo Enhancer 2.2.3.2 Portable by Жека

1.4 GB

/App/PhotoEnhancer/PublicPlugin/ProcessingproxyPlugin.dll

145.8 KB
 

Showing first 1 matched files of 1261 total files

[ CourseWikia.com ] Artificial Intelligence and ChatGPT for Beginners

1.4 GB

/~Get Your Files Here !/3. Natural Language Processing (NLP)/1. Natural Language Processing (NLP).mp4

175.4 MB
 

Showing first 1 matched files of 8 total files

Gunsmith.Simulator.v0.19.14

13.2 GB

/Gunsmith.Simulator.v0.19.14/game/Gunsmith Simulator_Data/Managed/Unity.Postprocessing.Runtime.dll

147.5 KB
 

Showing first 1 matched files of 184 total files

The Library Of Babel

1.5 GB

/The Library of Babel_Data/Managed/Unity.Postprocessing.Runtime.dll

148.0 KB
 

Showing first 1 matched files of 340 total files
«« « Back Next » »»

Copyright © 2025 FileMood.com