FileMood

Showing results 23 to 42 of about 258 for elasticache

[FreeCoursesOnline.Me] PacktPub - AWS Certified Cloud Practitioner (CLF-C01) [Video]

0/2

2.9 GB

/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4

35.1 MB

 

Showing first 1 matched files of 92 total files

[FreeTutorials.Us] Udemy - AWS Certified Solutions Architect - Professional 2019

0/2

16.9 GB

/3. New Domain 2 - Design for New Solutions/66. Understanding ElastiCache in AWS.mp4

12.8 MB

/3. New Domain 2 - Design for New Solutions/66. Understanding ElastiCache in AWS.srt

5.8 KB

/3. New Domain 2 - Design for New Solutions/66. Understanding ElastiCache in AWS.vtt

5.1 KB

/3. New Domain 2 - Design for New Solutions/67. ElastiCache - Deploying Memcached Cluster Engine.mp4

28.3 MB

/3. New Domain 2 - Design for New Solutions/67. ElastiCache - Deploying Memcached Cluster Engine.srt

10.8 KB

 

Showing first 5 matched files of 727 total files

LinuxAcademy - AWS Certified Solutions Architect Professional Level

1/1

5.2 GB

/10. Amazon ElastiCache/1 ElastiCache Overview.ts

113.7 MB

/10. Amazon ElastiCache/2 ElastiCache Memcache.ts

54.3 MB

/10. Amazon ElastiCache/3 ElastiCache Redis.ts

71.4 MB

 

Showing first 3 matched files of 83 total files

[ FreeCourseWeb.com ] Build Microservices with Python and AWS

1/0

3.4 GB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/paginators-1.json

2.2 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/service-2.json

223.0 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/waiters-2.json

3.7 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2015-02-02/examples-1.json

111.6 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2015-02-02/paginators-1.json

3.0 KB

 

Showing first 5 matched files of 3063 total files

Pluralsight - AWS Certified SysOps Admin - Associate 2023 by Faye Ellis

1/0

3.7 GB

/06. Reliability and Business Continuity/07. Using AWS ElastiCache.mp4

14.9 MB

/06. Reliability and Business Continuity/07. Using AWS ElastiCache.srt

9.6 KB

 

Showing first 2 matched files of 382 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023

1/0

14.7 GB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache English.vtt

9.1 KB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/203 - AWS ElastiCache.mp4

40.5 MB

 

Showing first 2 matched files of 437 total files

[FreeCoursesOnline.Me] SkillShare - AWS Certified Cloud Practitioner 2020

0/1

2.7 GB

/58 - 59-elasticache-and-redis.mp4

14.8 MB

 

Showing first 1 matched files of 73 total files

SAP-C01 AWS Certified Solution Architect Professional - DolphinEd

0/1

13.2 GB

/6. Domain #5 - Data Storage/5. Amazon ElastiCache.mp4

141.9 MB

 

Showing first 1 matched files of 123 total files

[Tutorialsplanet.NET] Udemy - AWS Certified Developer - Associate 2020

0/1

8.4 GB

/3. Beginners Guide to EC2/11. Elasticache 101.mp4

65.8 MB

/3. Beginners Guide to EC2/11. Elasticache 101.vtt

9.2 KB

/6. DynamoDB/8. Elasticache.mp4

83.4 MB

/6. DynamoDB/8. Elasticache.vtt

10.5 KB

 

Showing first 4 matched files of 351 total files

[FreeCourseLab.com] Udemy - AWS Certified Solutions Architect - Associate [New Exam]

1/0

18.8 GB

/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.mp4

34.5 MB

/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.vtt

16.5 KB

/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.mp4

12.8 MB

/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.vtt

5.6 KB

/21. AWS Services/3. AWS Services - 1-3) Elasticache for Memcached.mp4

16.0 MB

 

Showing first 5 matched files of 860 total files

[FreeCourseLab.com] Udemy - Ultimate AWS Certified Developer Associate 2019 - NEW!

1/0

6.3 GB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/1. AWS Fundamentals III - Section Introduction.mp4

11.5 MB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/1. AWS Fundamentals III - Section Introduction.vtt

0.7 KB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.mp4

17.1 MB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.vtt

7.7 KB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/3. AWS Route 53 Hands On.mp4

34.4 MB

 

Showing first 5 matched files of 385 total files

PacktPub - AWS Certified Cloud Practitioner (CLF-C01)

2.9 GB

/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4

35.1 MB

 

Showing first 1 matched files of 92 total files

[04-2022] docker-and-kubernetes-the-complete-guide

14.1 GB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt

6.5 KB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4

27.3 MB

 

Showing first 2 matched files of 662 total files

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program

7.1 GB

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4

134.7 MB

 

Showing first 1 matched files of 72 total files

itpro.tv

163.2 GB

/Amazom/AWS Certified Solutions Architect - Associate/10.1 - Amazon ElastiCache.mp4

109.9 MB

 

Showing first 1 matched files of 865 total files

[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02

4.4 GB

/12 - Databases and Analytics/009 Amazon ElastiCache.mp4

14.6 MB

/12 - Databases and Analytics/009 Amazon ElastiCache_en.srt

6.9 KB

/12 - Databases and Analytics/010 Scaling ElastiCache.mp4

10.5 MB

/12 - Databases and Analytics/010 Scaling ElastiCache_en.srt

4.8 KB

/12 - Databases and Analytics/011 [HOL] Create ElastiCache Cluster.mp4

37.4 MB

 

Showing first 5 matched files of 411 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4

47.0 MB

 

Showing first 1 matched files of 120 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB

 

Showing first 2 matched files of 612 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB

 

Showing first 2 matched files of 696 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB

 

Showing first 1 matched files of 138 total files


Copyright © 2025 FileMood.com