|
1/1 |
791.6 MB |
||
|
|
17.1 KB |
|
Showing first 1 matched files of 635 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
4. Domain 3 Processing/25. EMR Security and Instance Types.mp4 |
48.4 MB |
|
4. Domain 3 Processing/25. EMR Security and Instance Types.srt |
10.0 KB |
|
|
16.1 MB |
|
|
4.2 KB |
|
Showing first 4 matched files of 612 total files |
|
|
|
70.7 GB |
||
|
Engine/Binaries/ThirdParty/Python3/Win64/Lib/lib2to3/fixes/fix_isinstance.py |
1.7 KB |
|
Showing first 1 matched files of 3519 total files |
|
|
|
68.7 GB |
||
|
Engine/Binaries/ThirdParty/Python3/Win64/Lib/lib2to3/fixes/fix_isinstance.py |
1.7 KB |
|
Showing first 1 matched files of 3491 total files |
|
|
|
74.5 GB |
||
|
|
2.9 KB |
|
Showing first 1 matched files of 1818 total files |
|
|
|
11.7 GB |
||
|
|
19.3 MB |
|
|
19.3 MB |
|
|
19.3 MB |
|
|
19.3 MB |
|
|
19.3 MB |
|
Showing first 5 matched files of 1645 total files |
|
|
|
23.1 GB |
||
|
Craftopia_Data/Managed/InstancedIndirectRenderer.Runtime.dll |
22.0 KB |
|
|
5.1 KB |
|
Showing first 2 matched files of 2001 total files |
|
|
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/027 CodeDeploy - On-Premise Instances Setup.mkv |
130.0 MB |
|
06 - Policies and Standards Automation (Domain 4)/021 EC2 Instance Compliance.mkv |
10.0 MB |
|
Showing first 2 matched files of 242 total files |
|
|
|
1.4 GB |
||
|
|
38.6 MB |
|
|
69.2 MB |
|
06-step_involved_in_creation_of_linux_instance_and_access_through_putty.mkv |
162.5 MB |
|
Showing first 3 matched files of 25 total files |
|
|
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
03 - SDLC Automation (Domain 1)/027 CodeDeploy - On-Premise Instances Setup.mkv |
130.0 MB |
|
06 - Policies and Standards Automation (Domain 4)/021 EC2 Instance Compliance.mkv |
10.0 MB |
|
Showing first 2 matched files of 234 total files |
|
|
[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass |
|
6.3 GB |
|
|
|
95.9 GB |
||
|
The Witcher 3/content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws |
2.1 KB |
|
The Witcher 3/content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws |
5.3 KB |
|
Showing first 2 matched files of 3110 total files |
|
|
[GigaCourse.Com] Udemy - The JavaScript Bible - JavaScript Bootcamp |
|
16.1 GB |
|
|
12 - JAVASCRIPT BASICS - Advanced Topics/002 PRACTICE - typeof and instanceof Operators.mp4 |
65.3 MB |
|
12 - JAVASCRIPT BASICS - Advanced Topics/002 PRACTICE - typeof and instanceof Operators_en.srt |
19.5 KB |
|
|
10.7 MB |
|
|
4.3 KB |
|
Showing first 4 matched files of 799 total files |
|
|
[ CourseBoat.com ] helloluxx - learn. Houdini. In Bloom with Rich Nosworthy |
|
1.2 GB |
|
|
~Get Your Files Here !/learn. Houdini. In Bloom-Chapter23_InstanceFileAttribute-1080P .flv |
25.6 MB |
|
Showing first 1 matched files of 34 total files |
|
|
|
2.5 GB |
||
|
|
58.9 MB |
|
|
12.2 KB |
|
|
100.6 MB |
|
|
17.2 KB |
|
Showing first 4 matched files of 69 total files |
|
|
The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes |
|
95.5 GB |
|
|
content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws |
2.1 KB |
|
content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws |
5.3 KB |
|
Showing first 2 matched files of 2967 total files |
|
|
[ DevCourseWeb.com ] Udemy - Event-Driven Microservices - Spring Boot, Kafka and Elastic |
|
4.0 GB |
|
|
|
1.6 KB |
|
|
1.6 KB |
|
|
1.6 KB |
|
|
1.6 KB |
|
|
2.9 KB |
|
Showing first 5 matched files of 3550 total files |
|
|
|
6.5 GB |
||
|
|
23.1 MB |
|
Showing first 1 matched files of 124 total files |
|
|
|
4.0 GB |
||
|
|
36.1 MB |
|
|
32.5 MB |
|
Showing first 2 matched files of 130 total files |
|
|
The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen.GOG.Rip-InsaneRamZes |
|
59.8 GB |
|
|
|
2.1 KB |
|
|
5.3 KB |
|
Showing first 2 matched files of 2522 total files |
|
Copyright © 2026 FileMood.com