FileMood

Showing results 28 to 47 of about 258 for elasticache

itpro.tv

0/1

163.2 GB

/Amazom/AWS Certified Solutions Architect - Associate/10.1 - Amazon ElastiCache.mp4

109.9 MB

 

Showing first 1 matched files of 865 total files

AWS Certified Cloud Practitioner 2020

0/1

9.2 GB

/[TutsNode.com] - AWS Certified Cloud Practitioner 2020/02 Understanding Core AWS Services/076 AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 237 total files

[FreeCoursesOnline.Me] SkillShare - AWS Certified Cloud Practitioner 2020

0/1

2.7 GB

/58 - 59-elasticache-and-redis.mp4

14.8 MB

 

Showing first 1 matched files of 73 total files

[Tutorialsplanet.NET] Udemy - AWS Certified Developer - Associate 2020

0/1

8.4 GB

/3. Beginners Guide to EC2/11. Elasticache 101.mp4

65.8 MB

/3. Beginners Guide to EC2/11. Elasticache 101.vtt

9.2 KB

/6. DynamoDB/8. Elasticache.mp4

83.4 MB

/6. DynamoDB/8. Elasticache.vtt

10.5 KB

 

Showing first 4 matched files of 351 total files

[FreeCourseLab.com] Udemy - AWS Certified Solutions Architect - Associate [New Exam]

1/0

18.8 GB

/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.mp4

34.5 MB

/21. AWS Services/1. AWS Services - 1-1) Elasticache Introduction.vtt

16.5 KB

/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.mp4

12.8 MB

/21. AWS Services/2. AWS Services - 1-2) ElastiCache - Caching Strategies.vtt

5.6 KB

/21. AWS Services/3. AWS Services - 1-3) Elasticache for Memcached.mp4

16.0 MB

 

Showing first 5 matched files of 860 total files

[ FreeCourseWeb.com ] Build Microservices with Python and AWS

3.4 GB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/paginators-1.json

2.2 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/service-2.json

223.0 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2014-09-30/waiters-2.json

3.7 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2015-02-02/examples-1.json

111.6 KB

/~Get Your Files Here !/6. Building Serverless Microservices/python/botocore/data/elasticache/2015-02-02/paginators-1.json

3.0 KB

 

Showing first 5 matched files of 3063 total files

[04-2022] docker-and-kubernetes-the-complete-guide

14.1 GB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt

6.5 KB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4

27.3 MB

 

Showing first 2 matched files of 662 total files

[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02

4.4 GB

/12 - Databases and Analytics/009 Amazon ElastiCache.mp4

14.6 MB

/12 - Databases and Analytics/009 Amazon ElastiCache_en.srt

6.9 KB

/12 - Databases and Analytics/010 Scaling ElastiCache.mp4

10.5 MB

/12 - Databases and Analytics/010 Scaling ElastiCache_en.srt

4.8 KB

/12 - Databases and Analytics/011 [HOL] Create ElastiCache Cluster.mp4

37.4 MB

 

Showing first 5 matched files of 411 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4

47.0 MB

 

Showing first 1 matched files of 120 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB

 

Showing first 2 matched files of 612 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB

 

Showing first 2 matched files of 696 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB

 

Showing first 1 matched files of 138 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.mp4

44.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.srt

21.9 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.mp4

34.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.srt

18.6 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/4. Amazon ElastiCache - Caching Strategies.mp4

12.8 MB

 

Showing first 5 matched files of 1023 total files

UD151

11.5 GB

/11 Databases/187 Amazon ElastiCache Overview.mp4

33.8 MB

/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4

36.6 MB

/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4

56.2 MB

/11 Databases/190 ElastiCache Redis AUTH.mp4

7.4 MB

/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4

61.2 MB

 

Showing first 5 matched files of 275 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2020

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB

 

Showing first 1 matched files of 135 total files

Anirban Saha - Salt Cookbook - 2015

1.8 MB

/Code/cookbook/chapter09/05_elasticache_clusters/elasticache.sls

0.3 KB

 

Showing first 1 matched files of 89 total files

[OTUS] AWS для разработчиков (Часть 1-3) (2020)

5.5 GB

/15 ElastiCache/cloud_lec_DBS2.pptx

365.6 KB

/15 ElastiCache/zoom.mp4

55.9 MB

 

Showing first 2 matched files of 58 total files

UD610

3.6 GB

/aws-certified-cloud-practitioner-new/09 Databases Analytics/085 ElastiCache Overview.mp4

8.1 MB

 

Showing first 1 matched files of 196 total files


Copyright © 2025 FileMood.com