FileMood

Showing results 29 to 48 of about 257 for elasticache

[FreeCoursesOnline.Me] A Cloud Guru - AWS Certified SysOps Administrator - Associate 2020

0/1

4.8 GB

/02 Monitoring Reporting/005 Elasticache Metrics.html

14.1 KB

/02 Monitoring Reporting/005 Monitoring Elasticache.mp4

24.1 MB

/04 High Availability/009 Elasticache.mp4

27.4 MB
 

Showing first 3 matched files of 169 total files

[FreeCourseWorld.Com] Udemy - AWS Certified Big Data Specialty 2020 - In Depth & Hands On!

0/1

5.4 GB

/03 Domain 2 Storage/047 ElastiCache Overview.en.srt

3.7 KB

/03 Domain 2 Storage/047 ElastiCache Overview.mp4

11.7 MB
 

Showing first 2 matched files of 270 total files

SAP-C01 AWS Certified Solution Architect Professional - DolphinEd

0/1

13.2 GB

/6. Domain #5 - Data Storage/5. Amazon ElastiCache.mp4

141.9 MB
 

Showing first 1 matched files of 123 total files

[Tutorialsplanet.NET] Udemy - AWS Certified Developer - Associate 2020

0/1

8.4 GB

/3. Beginners Guide to EC2/11. Elasticache 101.mp4

65.8 MB

/3. Beginners Guide to EC2/11. Elasticache 101.vtt

9.2 KB

/6. DynamoDB/8. Elasticache.mp4

83.4 MB

/6. DynamoDB/8. Elasticache.vtt

10.5 KB
 

Showing first 4 matched files of 351 total files

[FreeCourseLab.com] Udemy - AWS Certified Solutions Architect - Associate 2018

1/0

8.5 GB

/7. Databases on AWS/6. Elasticache.mp4

10.9 MB

/7. Databases on AWS/6. Elasticache.vtt

5.4 KB
 

Showing first 2 matched files of 267 total files

[Tutorialsplanet.NET] Udemy - Docker and Kubernetes The Complete Guide

1/0

12.7 GB

/11. Multi-Container Deployments to AWS/10. ElastiCache Redis Creation.mp4

38.2 MB

/11. Multi-Container Deployments to AWS/10. ElastiCache Redis Creation.vtt

5.9 KB
 

Showing first 2 matched files of 547 total files

[FreeCourseLab.com] Udemy - Ultimate AWS Certified Developer Associate 2019 - NEW!

1/0

6.3 GB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/1. AWS Fundamentals III - Section Introduction.mp4

11.5 MB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/1. AWS Fundamentals III - Section Introduction.vtt

0.7 KB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.mp4

17.1 MB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/2. AWS Route 53 Overview.vtt

7.7 KB

/5. AWS Fundamentals Route 53 + RDS + ElastiCache + VPC/3. AWS Route 53 Hands On.mp4

34.4 MB
 

Showing first 5 matched files of 385 total files

PacktPub - AWS Certified Cloud Practitioner (CLF-C01)

2.9 GB

/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4

35.1 MB
 

Showing first 1 matched files of 92 total files

[04-2022] docker-and-kubernetes-the-complete-guide

14.1 GB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.en_US.srt

6.5 KB

/11 Multi-Container Deployments to AWS/163 ElastiCache Redis Creation.mp4

27.3 MB
 

Showing first 2 matched files of 662 total files

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program

7.1 GB

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4

134.7 MB
 

Showing first 1 matched files of 72 total files

itpro.tv

0/1

163.2 GB

/Amazom/AWS Certified Solutions Architect - Associate/10.1 - Amazon ElastiCache.mp4

109.9 MB
 

Showing first 1 matched files of 865 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/072. Chapter 11. Caching data in memory Amazon ElastiCache and MemoryDB.mp4

47.0 MB
 

Showing first 1 matched files of 120 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB
 

Showing first 2 matched files of 612 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB
 

Showing first 2 matched files of 696 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB
 

Showing first 1 matched files of 138 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB
 

Showing first 1 matched files of 135 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.mp4

44.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.srt

21.9 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.mp4

34.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.srt

18.6 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/4. Amazon ElastiCache - Caching Strategies.mp4

12.8 MB
 

Showing first 5 matched files of 1023 total files

UD151

11.5 GB

/11 Databases/187 Amazon ElastiCache Overview.mp4

33.8 MB

/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4

36.6 MB

/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4

56.2 MB

/11 Databases/190 ElastiCache Redis AUTH.mp4

7.4 MB

/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4

61.2 MB
 

Showing first 5 matched files of 275 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB
 

Showing first 1 matched files of 135 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2020

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB
 

Showing first 1 matched files of 135 total files
«« « Back Next » »»

Copyright © 2025 FileMood.com