functions | 3020 to 3039 | Download files with FileMood

Welcome Guest
Log In
Register

Showing results 3020 to 3039 of about 5000 for functions

Conan Exiles [U53-471559-36636] (AoS-320)		97.0 GB	DOWNLOAD

/Engine/Content/Paks/Functions.pak	1.0 MB
/Engine/Content/Paks/Functions.sig	0.1 KB
Showing first 2 matched files of 693 total files

[FreeCourseSite.com] Udemy - Server Side Rendering with React and Redux		4.5 GB	DOWNLOAD

/07 - Server Side Data Loading/007 LoadData Functions.mp4	162.3 MB
Showing first 1 matched files of 178 total files

[ DevCourseWeb.com ] Udemy - Mastering Excel 2021 - Intermediate		2.9 GB	DOWNLOAD

/~Get Your Files Here !/3 - Formatting/16 - Functions in Conditional Formatting.mp4	78.4 MB
/~Get Your Files Here !/4 - Functions/17 - Nested Functions.mp4	138.3 MB
/~Get Your Files Here !/4 - Functions/18 - Logical Functions.mp4	73.9 MB
/~Get Your Files Here !/4 - Functions/19 - Statistical Functions.mp4	110.2 MB
Showing first 4 matched files of 38 total files

GetFreeCourses.Co-Udemy-SQL - The Complete Developer's Guide (MySQL, PostgreSQL)		8.7 GB	DOWNLOAD

/08 - Grouping & Aggregate Functions/001 Module Introduction.mp4	6.8 MB
/08 - Grouping & Aggregate Functions/001 Module Introduction_en.srt	2.2 KB
/08 - Grouping & Aggregate Functions/002 The Module Project.mp4	21.6 MB
/08 - Grouping & Aggregate Functions/002 The Module Project_en.srt	7.0 KB
/08 - Grouping & Aggregate Functions/003 What are Aggregate Functions - Theory.mp4	24.3 MB
Showing first 5 matched files of 439 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes		95.6 GB	DOWNLOAD

/content/content0/scripts/game/quests/functions/bossFights.ws	11.6 KB
/content/content0/scripts/game/quests/functions/tutorial.ws	56.3 KB
/content/content0/scripts/game/scenes/scene_functions.ws	58.3 KB
Showing first 3 matched files of 2976 total files

Terraform		2.3 GB	DOWNLOAD

/1. Terraform - Getting Started/07-17 - Using Functions and Looping in Your Configuration -- Summary.mp4	778.1 KB
/1. Terraform - Getting Started/07-01 - Using Functions and Looping in Your Configuration -- Overview.mp4	1.6 MB
/1. Terraform - Getting Started/07-06 - Using Functions and Looping in Your Configuration -- Looping Targets.mp4	1.9 MB
/1. Terraform - Getting Started/07-02 - Using Functions and Looping in Your Configuration -- Globomantics Updates.mp4	2.1 MB
/1. Terraform - Getting Started/07-03 - Using Functions and Looping in Your Configuration -- Loops in Terraform.mp4	2.4 MB
Showing first 5 matched files of 318 total files

[Skillshare] Unreal Engine 5 Blueprints for Beginners [ENG-RUS]		4.9 GB	DOWNLOAD

/19 What are Events, Functions & Macros.mkv	28.2 MB
/21 Functions.mkv	45.6 MB
/27 Array Functions.mkv	27.5 MB
/28 What are Execution Flow Functions.mkv	21.3 MB
Showing first 4 matched files of 71 total files

Stranded Deep (2022)		2.3 GB	DOWNLOAD

/Stranded Deep/Stranded_Deep_Data/Managed/Rewired_Windows_Functions.dll	4.1 KB
Showing first 1 matched files of 215 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes		95.5 GB	DOWNLOAD

/content/content0/scripts/game/quests/functions/bossFights.ws	11.6 KB
/content/content0/scripts/game/quests/functions/tutorial.ws	56.3 KB
/content/content0/scripts/game/scenes/scene_functions.ws	58.3 KB
Showing first 3 matched files of 2961 total files

render.camp - PV 9.0		74.9 GB	DOWNLOAD

/03. Technical Basics/RMB Functions.mp4	11.9 MB
Showing first 1 matched files of 164 total files

Stranded Deep		4.2 GB	DOWNLOAD

/Stranded_Deep_Data/Managed/Rewired_Windows_Functions.dll	4.1 KB
Showing first 1 matched files of 232 total files

Drake Surach - ChatGTP Mastery Course (www.imarketing.courses)		7.6 GB	DOWNLOAD

/02-Beginner's Prompting/04-System functions.mp4	460.8 MB
/02-Beginner's Prompting/04-System functions.png	202.6 KB
/02-Beginner's Prompting/04-System functions.rtf	42.9 KB
Showing first 3 matched files of 86 total files

Ultimate ASP.NET Core 3 Web API (2021) [En]		625.9 MB	DOWNLOAD

/First edition/All Materials in .NET 5/Bonus 6 - Security/01-Setting up IS4 and UI/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/03-Securing the Web Application/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/04-Authorization and Working with Claims/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/05-Securing Web API/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/06-Expiration and Reference tokens/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
Showing first 5 matched files of 19018 total files

udemy-course-downloader-arduino-programming-and-hardware-fundamentals-with-hackster		1.6 GB	DOWNLOAD

/02. Programming Basics/13. Writing Functions.mp4	19.2 MB
Showing first 1 matched files of 181 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata		6.7 GB	DOWNLOAD

/4. Domain 3 Processing/30. AWS Step Functions.mp4	20.2 MB
/4. Domain 3 Processing/30. AWS Step Functions.srt	7.2 KB
Showing first 2 matched files of 612 total files

free-course-site.com-udemy-java-for-complete-beginners		510.7 MB	DOWNLOAD

/6. Functions/1. What is function .mp4	8.9 MB
/6. Functions/1. What is function .vtt	1.5 KB
/6. Functions/2. CODE Functions.mp4	9.5 MB
/6. Functions/2. CODE Functions.vtt	5.3 KB
/6. Functions/2.1 Functions.zip.zip	15.4 KB
Showing first 5 matched files of 106 total files

BnS		70.7 GB	DOWNLOAD

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_functions.py	13.0 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_memfunctions.py	3.4 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/sqlite3/test/userfunctions.py	15.6 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/tkinter/test/test_ttk/test_functions.py	17.6 KB
Showing first 4 matched files of 3519 total files

BnS		68.7 GB	DOWNLOAD

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_functions.py	13.0 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_memfunctions.py	3.4 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/sqlite3/test/userfunctions.py	15.6 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/tkinter/test/test_ttk/test_functions.py	17.6 KB
Showing first 4 matched files of 3491 total files

Daum PotPlayer 1.7.21990 + OpenCodec		96.8 MB	DOWNLOAD

/daumfix/system/Networking/UtilityFunctions.ps1	54.7 KB
Showing first 1 matched files of 304 total files

Microsoft-Toolkit-2.7.3		17.5 MB	DOWNLOAD

/diag fix/system/Networking/UtilityFunctions.ps1	54.7 KB
Showing first 1 matched files of 305 total files

«« « Back Next » »»

Copyright © 2025 FileMood.com