FileMood

Showing results 3060 to 3079 of about 5000 for lecture

[ CourseWikia.com ] Dating In Spanish - Master Romance With Fun Language Skills

2.4 GB

/~Get Your Files Here !/8 - Bonus/32 - Bonus Lecture.mp4

34.9 MB

 

Showing first 1 matched files of 34 total files

ucberkeley_webcast_TTK2lZoWbPQ

335.7 MB

/Computer Science 61A - Lecture 2 - functional programming 2-TTK2lZoWbPQ.info.json

26.8 KB

/Computer Science 61A - Lecture 2 - functional programming 2-TTK2lZoWbPQ.mp4

124.8 MB

/Computer Science 61A - Lecture 2 - functional programming 2-TTK2lZoWbPQ.ogv

210.8 MB

 

Showing first 3 matched files of 6 total files

GetFreeCourses.Co-Udemy-SQL - The Complete Developer's Guide (MySQL, PostgreSQL)

8.7 GB

/03 - Course Setup_ Installing MySQL & Postgresql/004 You Can Skip The Next Lectures_.html

0.5 KB

 

Showing first 1 matched files of 439 total files

Various Artists - Milk & Sugar House Nation Ibiza 2023 (2023) Mp3 320kbps [PMEDIA] ⭐️

466.5 MB

/CD2/06 - Momo Khani & Meindel feat. StanLei - Lecture (DJ Phellix Extended Remix).mp3

10.1 MB

 

Showing first 1 matched files of 31 total files

[ CourseMega.com ] Udemy - Positive Energy , Fuel Of Your Business and Life

1.4 GB

/~Get Your Files Here !/4 - Bonus/22 - Bonus lecture Other cool stuff.html

0.8 KB

 

Showing first 1 matched files of 58 total files

[ CourseLala.com ] Udemy - Ink drawing for Beginners and Beyond

2.7 GB

/~Get Your Files Here !/001 Introduction and lecture 1-recommended pens and equipment.mp4

183.5 MB

/~Get Your Files Here !/001 Introduction and lecture 1-recommended pens and equipment_en.vtt

6.3 KB

/~Get Your Files Here !/002 Lecture 2- hatching techniques.mp4

400.7 MB

/~Get Your Files Here !/002 Lecture 2- hatching techniques_en.vtt

8.6 KB

/~Get Your Files Here !/003 Lecture 3- trees.mp4

507.4 MB

 

Showing first 5 matched files of 26 total files

MITHST.512S04

1.2 GB

/Lecture1-16k.mp3

34.2 MB

/Lecture1-16k.ogg

19.4 MB

/Lecture1-16k.png

8.8 KB

/Lecture1-16k.rm

9.5 MB

/Lecture10-16k.mp3

38.5 MB

 

Showing first 5 matched files of 78 total files

zero-to-mastery-master-the-coding-interview-data-structures-algorithms

13.9 GB

/22 - BONUS SECTION/001 Bonus Lecture.html

1.2 KB

 

Showing first 1 matched files of 1480 total files

podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250

14.9 MB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250.m4a

12.8 MB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_itemimage.png

2.0 MB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_itunes.json

1.2 KB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_meta.sqlite

16.4 KB

/podcast_24-heures-de-lecture-romainm_voyage-au-bout-de-la-nuit_1000441536250_meta.xml

1.6 KB

 

Showing first 5 matched files of 6 total files

ManlyP.Hall-CompleteLectureSeries-Part2

56.4 MB

/ManlyP.Hall-CompleteLectureSeries-Part2_meta.xml

0.9 KB

 

Showing first 1 matched files of 12 total files

podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855

74.1 MB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855.mp3

73.9 MB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_itemimage.png

132.7 KB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_itunes.json

1.8 KB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_meta.sqlite

21.5 KB

/podcast_law-school-lectures-audio_keynote-address-creating-cap_1000088897855_meta.xml

2.3 KB

 

Showing first 5 matched files of 6 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/12. Wrapping Up/3. Bonus Lecture Special discounts for our other courses.html

11.3 KB

 

Showing first 1 matched files of 612 total files

free-course-site.com-udemy-java-for-complete-beginners

510.7 MB

/9. Bonus/1. Bonus Lecture Algorithms and Data Structures in Java.html

0.8 KB

 

Showing first 1 matched files of 106 total files

[Metart] August 2023 SiteRip 2160p

28.0 GB

/_Screens/metart.23.08.13.krystal.kitten.ginger.lecture.4k_s.jpg

865.9 KB

/metart.23.08.13.krystal.kitten.ginger.lecture.4k.mp4

2.6 GB

 

Showing first 2 matched files of 18 total files

[ FreeCryptoLearn.com ] Udemy - Export Finance, Priority Sector, Retail Loan and Documentation

1.9 GB

/~Get Your Files Here !/7 - Last Section/121 - Bonus Lecture.html

0.1 KB

/~Get Your Files Here !/7 - Last Section/121 - BonusLecture.pdf

239.1 KB

 

Showing first 2 matched files of 244 total files

nand2tetris

1.1 GB

/lectures/chapter 1 lecture.pdf

11.5 MB

/lectures/chapter 1 lecture_chocr.html.gz

430.7 KB

/lectures/chapter 1 lecture_djvu.txt

30.6 KB

/lectures/chapter 1 lecture_djvu.xml

495.9 KB

/lectures/chapter 1 lecture_hocr.html

1.1 MB

 

Showing first 5 matched files of 745 total files

Melon Player4

142.2 MB

/html/popupPaymentTabLectureDCF.html

20.6 KB

/html/popupPaymentTabLectureFREE.html

9.9 KB

/html/popupPaymentTabLectureMP3.html

17.4 KB

/html/tabContentsInfoLecture.html

4.6 KB

 

Showing first 4 matched files of 529 total files

[Tutorialsplanet.NET] Udemy - Microsoft Power BI - The Practical Guide [2022 EDITION]

12.2 GB

/15 [OLD COURSE] Working in the Query Editor/010 [Please Read]_ Important Hint for the Next Lecture.html

1.8 KB

 

Showing first 1 matched files of 687 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/002 CloudFormation_ Lectures.html

0.4 KB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/022 === CloudFormation Lectures from DevOps course ===.html

0.1 KB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/059 === ECS Lectures from Certified Developer Course ===.html

0.3 KB

/08 - Course Wrap-up/006 Bonus Lecture_ Practice Exam & Special discounts for our other courses.html

7.1 KB

 

Showing first 4 matched files of 242 total files

[ DevCourseWeb.com ] Udemy - System Design Essentials - Server Design Fundamental Overview

307.6 MB

/~Get Your Files Here !/3. Tools To measure performance and profile servers/1. Demo C++ code used in the following lectures to genreate measurements.mp4

15.2 MB

/~Get Your Files Here !/3. Tools To measure performance and profile servers/1. Demo C++ code used in the following lectures to genreate measurements.srt

4.2 KB

/~Get Your Files Here !/4. Conclusion/1. [Bonus lecture].html

0.1 KB

 

Showing first 3 matched files of 66 total files


Copyright © 2025 FileMood.com