functions | 3140 to 3159 | Download files with FileMood

Welcome Guest
Log In
Register

Showing results 3140 to 3159 of about 5000 for functions

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes		95.5 GB	DOWNLOAD

/content/content0/scripts/game/quests/functions/bossFights.ws	11.6 KB
/content/content0/scripts/game/quests/functions/tutorial.ws	56.3 KB
/content/content0/scripts/game/scenes/scene_functions.ws	58.3 KB
Showing first 3 matched files of 2961 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes		95.5 GB	DOWNLOAD

/content/content0/scripts/game/quests/functions/bossFights.ws	11.6 KB
/content/content0/scripts/game/quests/functions/tutorial.ws	56.3 KB
/content/content0/scripts/game/scenes/scene_functions.ws	58.3 KB
Showing first 3 matched files of 2961 total files

render.camp - PV 9.0		74.9 GB	DOWNLOAD

/03. Technical Basics/RMB Functions.mp4	11.9 MB
Showing first 1 matched files of 164 total files

Stranded Deep		4.2 GB	DOWNLOAD

/Stranded_Deep_Data/Managed/Rewired_Windows_Functions.dll	4.1 KB
Showing first 1 matched files of 232 total files

Drake Surach - ChatGTP Mastery Course (www.imarketing.courses)		7.6 GB	DOWNLOAD

/02-Beginner's Prompting/04-System functions.mp4	460.8 MB
/02-Beginner's Prompting/04-System functions.png	202.6 KB
/02-Beginner's Prompting/04-System functions.rtf	42.9 KB
Showing first 3 matched files of 86 total files

Ultimate ASP.NET Core 3 Web API (2021) [En]		625.9 MB	DOWNLOAD

/First edition/All Materials in .NET 5/Bonus 6 - Security/01-Setting up IS4 and UI/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/03-Securing the Web Application/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/04-Authorization and Working with Claims/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/05-Securing Web API/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
/First edition/All Materials in .NET 5/Bonus 6 - Security/06-Expiration and Reference tokens/CompanyEmployees.IDP/wwwroot/lib/bootstrap/scss/_functions.scss	3.9 KB
Showing first 5 matched files of 19018 total files

udemy-course-downloader-arduino-programming-and-hardware-fundamentals-with-hackster		1.6 GB	DOWNLOAD

/02. Programming Basics/13. Writing Functions.mp4	19.2 MB
Showing first 1 matched files of 181 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata		6.7 GB	DOWNLOAD

/4. Domain 3 Processing/30. AWS Step Functions.mp4	20.2 MB
/4. Domain 3 Processing/30. AWS Step Functions.srt	7.2 KB
Showing first 2 matched files of 612 total files

free-course-site.com-udemy-java-for-complete-beginners		510.7 MB	DOWNLOAD

/6. Functions/1. What is function .mp4	8.9 MB
/6. Functions/1. What is function .vtt	1.5 KB
/6. Functions/2. CODE Functions.mp4	9.5 MB
/6. Functions/2. CODE Functions.vtt	5.3 KB
/6. Functions/2.1 Functions.zip.zip	15.4 KB
Showing first 5 matched files of 106 total files

BnS		70.7 GB	DOWNLOAD

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_functions.py	13.0 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_memfunctions.py	3.4 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/sqlite3/test/userfunctions.py	15.6 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/tkinter/test/test_ttk/test_functions.py	17.6 KB
Showing first 4 matched files of 3519 total files

BnS		68.7 GB	DOWNLOAD

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_functions.py	13.0 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/ctypes/test/test_memfunctions.py	3.4 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/sqlite3/test/userfunctions.py	15.6 KB
/Engine/Binaries/ThirdParty/Python3/Win64/Lib/tkinter/test/test_ttk/test_functions.py	17.6 KB
Showing first 4 matched files of 3491 total files

Daum PotPlayer 1.7.21990 + OpenCodec		96.8 MB	DOWNLOAD

/daumfix/system/Networking/UtilityFunctions.ps1	54.7 KB
Showing first 1 matched files of 304 total files

Microsoft-Toolkit-2.7.3		17.5 MB	DOWNLOAD

/diag fix/system/Networking/UtilityFunctions.ps1	54.7 KB
Showing first 1 matched files of 305 total files

[Tutorialsplanet.NET] Udemy - Microsoft Power BI - The Practical Guide [2022 EDITION]		12.2 GB	DOWNLOAD

/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/021 DAX Core Functions.en.srt	6.8 KB
/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/021 DAX Core Functions.mp4	12.2 MB
/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/025 Working with IF Functions.en.srt	10.6 KB
/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/025 Working with IF Functions.mp4	26.9 MB
/05 The Data Model_ Working with Relationships & DAX (Data Analysis Espressions)/026 Understanding Relationship Functions.en.srt	7.2 KB
Showing first 5 matched files of 687 total files

Cisco Certified DevNet Associate DEVASC 200-901		3.3 GB	DOWNLOAD

/Module 2 Python Fundamentals for DEVASC/Lesson 6 Getting Started with Python/007. 6.6 Functions en.srt	16.7 KB
/Module 2 Python Fundamentals for DEVASC/Lesson 6 Getting Started with Python/007. 6.6 Functions.mp4	20.9 MB
/Module 5 Network Fundamentals/Lesson 20 Common Networking Elements/002. 20.1 Network Device Functions en.srt	3.5 KB
/Module 5 Network Fundamentals/Lesson 20 Common Networking Elements/002. 20.1 Network Device Functions.mp4	6.8 MB
Showing first 4 matched files of 344 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!		10.3 GB	DOWNLOAD

/04 - Configuration Management and Infrastructure as Code (Domain 2)/012 CloudFormation Intrinsic Functions.mkv	27.5 MB
/04 - Configuration Management and Infrastructure as Code (Domain 2)/026 CloudFormation - Deploying Lambda Functions.mkv	115.2 MB
/04 - Configuration Management and Infrastructure as Code (Domain 2)/051 Step Functions - Overview.mkv	71.2 MB
/04 - Configuration Management and Infrastructure as Code (Domain 2)/058 API Gateway - Fronting Step Functions.mkv	68.5 MB
Showing first 4 matched files of 242 total files

[ TutPig.com ] Using Salesforce Marketing Cloud Connect		92.1 MB	DOWNLOAD

/~Get Your Files Here !/03. Explore Marketing Cloud Connect Features in Salesforce Marketing Cloud/11. Sales and Service Cloud AMPscript Functions.mp4	3.6 MB
Showing first 1 matched files of 15 total files

[ DevCourseWeb.com ] Udemy - JDBC, DAO and SQL - Practical Crash Course - Build Database App		3.6 GB	DOWNLOAD

/~Get Your Files Here !/05 - Relational Databases (Advanced)/001 Views, Triggers, Stored Procedures & Functions.mp4	228.4 MB
/~Get Your Files Here !/05 - Relational Databases (Advanced)/001 Views, Triggers, Stored Procedures & Functions_en.srt	39.9 KB
Showing first 2 matched files of 61 total files

Build an AutoGPT Code Writing AI Tool With Rust and GPT-4		8.8 GB	DOWNLOAD

/8. Auto GPT Project - Supporting Functions/1. Supporting Functions - Section Introduction.mp4	21.0 MB
/8. Auto GPT Project - Supporting Functions/15. API Endpoint Valid Check Function.mp4	22.5 MB
/8. Auto GPT Project - Supporting Functions/4. Extract API Keys.mp4	25.8 MB
/8. Auto GPT Project - Supporting Functions/7. OpenAI Call - Test API Call.mp4	36.7 MB
/8. Auto GPT Project - Supporting Functions/2. Project Setup.mp4	38.0 MB
Showing first 5 matched files of 136 total files

新しいフォルダー (3)		39.6 GB	DOWNLOAD

/IllusionFixes_Koikatsu_15.3.1/BepInEx/plugins/IllusionFixes/KK_Fix_RestoreMissingFunctions.dll	55.8 KB
Showing first 1 matched files of 755 total files

«« « Back Next » »»

Copyright © 2025 FileMood.com