FileMood

Showing results 333 to 352 of about 1165 for cloudt

LiveLessons - Amazon Web Services (AWS), 3rd Edition

4.0 GB

Module 11 AWS Security Services/Lesson 27 AWS Security Reporting/002. 27.1 AWS CloudTrail en.srt

4.6 KB

Module 11 AWS Security Services/Lesson 27 AWS Security Reporting/002. 27.1 AWS CloudTrail.mp4

13.0 MB

 

Showing first 2 matched files of 498 total files

VA - Tour De Traum (mixed by Riley Reinhold) [Traum Schallplatten] FLAC

37.5 GB

10. Tour De Traum XXV-2023/02-Efe Nazioğlu - Cloudtape (Original Mix).flac

47.8 MB

 

Showing first 1 matched files of 573 total files

Pluralsight - AWS Certified SysOps Admin - Associate 2023 by Faye Ellis

3.7 GB

04. Monitoring, Logging, and Remediation/10. Introduction to CloudTrail.mp4

17.1 MB

04. Monitoring, Logging, and Remediation/10. Introduction to CloudTrail.srt

8.8 KB

04. Monitoring, Logging, and Remediation/11. Demo- Working with CloudTrail.mp4

23.0 MB

04. Monitoring, Logging, and Remediation/11. Demo- Working with CloudTrail.srt

8.6 KB

07. Security and Compliance/23. Protecting Logs within CloudTrail.mp4

13.9 MB

 

Showing first 5 matched files of 382 total files

Mad Island 28.06.2024

1.5 GB

BepInEx/plugins/XUnity.AutoTranslator/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 256 total files

[FreeCoursesOnline.Me] LiveLessons - Amazon Web Services (AWS), 3rd Edition

4.0 GB

Module 11 AWS Security Services/Lesson 27 AWS Security Reporting/002. 27.1 AWS CloudTrail en.srt

4.6 KB

Module 11 AWS Security Services/Lesson 27 AWS Security Reporting/002. 27.1 AWS CloudTrail.mp4

13.0 MB

 

Showing first 2 matched files of 498 total files

Karl Brueggemann

7.3 GB

2021 - Wave Maker/05. Cloudtouch.flac

27.9 MB

 

Showing first 1 matched files of 474 total files

Mad Island 30.05.2024

1.5 GB

BepInEx/plugins/XUnity.AutoTranslator/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 272 total files

Mad Island [Build steam v012 28.06.24]

1.5 GB

BepInEx/plugins/XUnity.AutoTranslator/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 256 total files

Not Leader ver1.40 rus

2.6 GB

NotLeaderExp_Data/Managed/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 319 total files

Amazon Web Services (AWS), 3rd Edition

4.0 GB

Module 11 AWS Security Services/Lesson 27 AWS Security Reporting/002. 27.1 AWS CloudTrail en.srt

4.6 KB

Module 11 AWS Security Services/Lesson 27 AWS Security Reporting/002. 27.1 AWS CloudTrail.mp4

13.0 MB

 

Showing first 2 matched files of 494 total files

[FreeCourseSite.com] Udemy - [NEW] AWS Certified Advanced Networking Specialty 2023

7.0 GB

21 - AWS Management & Governance services/005 AWS CloudTrail.mp4

11.7 MB

21 - AWS Management & Governance services/005 AWS CloudTrail_en.srt

9.9 KB

 

Showing first 2 matched files of 450 total files

Survival Game_230723

1.2 GB

BepInEx/plugins/XUnity.AutoTranslator/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 231 total files

O`REILLY - AWS Account Setup Best Practices

4.4 GB

22.5.1 CloudTrail.mp4

92.6 MB

 

Showing first 1 matched files of 40 total files

Little Kitty Big City [CRACKSTATUS]

1.6 GB

Little Kitty, Big City_Data/Managed/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 396 total files

The_Cub_RUS_TeamRIG

659.0 MB

BepInEx/plugins/XUnity.AutoTranslator/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 79 total files

[ DevCourseWeb.com ] Udemy - Amazon DynamoDB - Advanced Developer's Guide

2.8 GB

~Get Your Files Here !/18. Advanced Security/2. Auditing Admin Access Using CloudTrail.mp4

82.2 MB

 

Showing first 1 matched files of 3303 total files

The Cub by CRACKSTATUS

12.0 GB

The Cub/BepInEx/plugins/XUnity.AutoTranslator/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 293 total files

Ero-Gen

23.2 GB

Rus/Ero-Gen v.1.0 RUS - Windows - Free Version/Ero-Gen Free_Data/Managed/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 294 total files

Samurai Vandalism

9.0 GB

UserLibs/Translators/LingoCloudTranslate.dll

7.2 KB

 

Showing first 1 matched files of 455 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

8. Domain 6 Security/11. CloudTrail.mp4

40.3 MB

8. Domain 6 Security/11. CloudTrail.srt

10.0 KB

 

Showing first 2 matched files of 612 total files


Copyright © 2026 FileMood.com