FileMood

Showing results 355 to 374 of about 2180 for relational

[CourserHub.com] Coursera - Coding for Everyone C and C++ Specialization

4.8 GB

/c-for-everyone/03_flow-of-control-and-simple-functions/01_relational-operators-and-expressions/01_logical-operators-expressions-and-short-circuit-evaluation.en.srt

6.9 KB

/c-for-everyone/03_flow-of-control-and-simple-functions/01_relational-operators-and-expressions/01_logical-operators-expressions-and-short-circuit-evaluation.en.txt

3.6 KB

/c-for-everyone/03_flow-of-control-and-simple-functions/01_relational-operators-and-expressions/01_logical-operators-expressions-and-short-circuit-evaluation.mp4

14.5 MB
 

Showing first 3 matched files of 554 total files

[FreeCourseSite.com] Udemy - Java for complete beginners Learn core java using IntelliJ

3.8 GB

/03 - Variables, Datatypes and Operators in Java/014 Relational Operators in Java.mp4

13.6 MB

/03 - Variables, Datatypes and Operators in Java/014 Relational Operators in Java_en.vtt

5.3 KB

/03 - Variables, Datatypes and Operators in Java/22075102-Relational-Operators-in-Java.pdf

40.6 KB
 

Showing first 3 matched files of 576 total files

[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02

4.4 GB

/12 - Databases and Analytics/002 Amazon Relational Database Service (RDS).mp4

11.4 MB

/12 - Databases and Analytics/002 Amazon Relational Database Service (RDS)_en.srt

6.1 KB
 

Showing first 2 matched files of 411 total files

[FreeCourseSite.com] Udemy - Mastering 4 critical SKILLS using C++ 17

12.6 GB

/05 - Operators/007 06-Relational-Operators.zip

268.5 KB

/05 - Operators/007 Relational Operators.mp4

30.4 MB

/05 - Operators/007 Relational Operators_en.vtt

6.6 KB

/34 - OOP Operator Overloading/005 Relational Operator Overloading.mp4

12.6 MB

/34 - OOP Operator Overloading/005 Relational Operator Overloading_en.vtt

2.9 KB
 

Showing first 5 matched files of 836 total files

Apna College ALPHA Full Course

37.1 GB

/06 Operators/4. Relational Operators.ts

40.1 MB
 

Showing first 1 matched files of 1236 total files

[ DevCourseWeb.com ] Udemy - The Complete C + + Programming Course - Mastering C + +

301.7 MB

/~Get Your Files Here !/2 - Relational Operators.mp4

12.1 MB
 

Showing first 1 matched files of 20 total files

[GigaCourse.Com] Udemy - Mastering 4 critical SKILLS using Python

11.8 GB

/5. Operators/05-Relational-Operators.zip

367.5 KB

/5. Operators/5. Relational Operators-en_US.srt

9.8 KB

/5. Operators/5. Relational Operators.mp4

36.8 MB
 

Showing first 3 matched files of 798 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/064. Chapter 10. Using a relational database service RDS.mp4

30.8 MB
 

Showing first 1 matched files of 120 total files

[ DevCourseWeb.com ] Udemy - Basics Of Ms Excel - A Beginner Course

1.2 GB

/~Get Your Files Here !/1 - Excel Basics/3 - Relational Operators English.vtt

2.6 KB

/~Get Your Files Here !/1 - Excel Basics/3 - Relational Operators.mp4

20.5 MB
 

Showing first 2 matched files of 42 total files

[ FreeCourseWeb.com ] Linkedin - Microsoft Foundational Career Certificate in Data Analytics

716.5 MB

/~Get Your Files Here !/07 - 6. Modeling Data/01 - Relational databases.mp4

12.1 MB

/~Get Your Files Here !/07 - 6. Modeling Data/01 - Relational databases.srt

4.3 KB
 

Showing first 2 matched files of 79 total files

[ CoursePig.com ] Linkedin - ASP.NET Core - Building a GraphQL API

1.2 GB

/~Get Your Files Here !/5. Querying and Mutating Relational Data with GraphQL in .NET Web API/023. Adding relationship data.en.srt

9.3 KB

/~Get Your Files Here !/5. Querying and Mutating Relational Data with GraphQL in .NET Web API/023. Adding relationship data.mp4

62.8 MB

/~Get Your Files Here !/5. Querying and Mutating Relational Data with GraphQL in .NET Web API/024. Query to get relational data.en.srt

5.0 KB

/~Get Your Files Here !/5. Querying and Mutating Relational Data with GraphQL in .NET Web API/024. Query to get relational data.mp4

36.6 MB

/~Get Your Files Here !/5. Querying and Mutating Relational Data with GraphQL in .NET Web API/025. Get relational data Testing.en.srt

1.7 KB
 

Showing first 5 matched files of 1486 total files

[ DevCourseWeb.com ] Udemy - C + + Complete Course For Beginners 2022

748.3 MB

/~Get Your Files Here !/5. C++ Relational Operators.mp4

12.6 MB

/~Get Your Files Here !/5. C++ Relational Operators.srt

2.4 KB
 

Showing first 2 matched files of 70 total files

GetFreeCourses.Co-Udemy-NodeJS - The Complete Guide (MVC, REST APIs, GraphQL, Deno)

20.2 GB

/12 Working with NoSQL & Using MongoDB/028 Adding Relational Order Data.en.srt

9.2 KB

/12 Working with NoSQL & Using MongoDB/028 Adding Relational Order Data.mp4

56.1 MB

/12 Working with NoSQL & Using MongoDB/202 11-adding-relational-order-data.zip

44.6 KB

/12 Working with NoSQL & Using MongoDB/206 11-adding-relational-order-data.zip

44.6 KB
 

Showing first 4 matched files of 1538 total files

Pluralsight - Java SE 17 Path

7.5 GB

/Java SE 17 Fundamentals/04. Conditional Logic and Block Statements/02. Conditional Logic and Relational Operators.mp4

5.7 MB

/Java SE 17 Fundamentals/04. Conditional Logic and Block Statements/02. Conditional Logic and Relational Operators.srt

7.0 KB
 

Showing first 2 matched files of 1936 total files

[ CourseWikia.com ] Udemy - SQL for NEWBS - Weekender Crash Course

1.8 GB

/~Get Your Files Here !/02 - Intro to MySQL/001 What the heck is a relational database.mp4

96.4 MB

/~Get Your Files Here !/02 - Intro to MySQL/001 What the heck is a relational database_en.srt

11.8 KB
 

Showing first 2 matched files of 88 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/6. Domain 4 Analysis/28. Amazon Relational Database Service (RDS) and Aurora.mp4

31.6 MB

/6. Domain 4 Analysis/28. Amazon Relational Database Service (RDS) and Aurora.srt

6.5 KB
 

Showing first 2 matched files of 612 total files

[ DevCourseWeb.com ] Udemy - JDBC, DAO and SQL - Practical Crash Course - Build Database App

3.6 GB

/~Get Your Files Here !/03 - Relational databases/001 Relational Databases Basic Concepts.mp4

150.4 MB

/~Get Your Files Here !/03 - Relational databases/001 Relational Databases Basic Concepts_en.srt

34.8 KB

/~Get Your Files Here !/03 - Relational databases/002 Create Schema & Table Naming, Collation, Engines, Types, Column Properties.mp4

271.6 MB

/~Get Your Files Here !/03 - Relational databases/002 Create Schema & Table Naming, Collation, Engines, Types, Column Properties_en.srt

48.4 KB

/~Get Your Files Here !/03 - Relational databases/003 Referential Integrity Foreign Key Constraint & Cascading Operations.mp4

178.6 MB
 

Showing first 5 matched files of 61 total files

[GigaCourse.Com] Udemy - Java for complete beginners Learn core java using IntelliJ

3.8 GB

/03 - Variables, Datatypes and Operators in Java/014 Relational Operators in Java.mp4

13.6 MB

/03 - Variables, Datatypes and Operators in Java/014 Relational Operators in Java_en.vtt

5.3 KB

/03 - Variables, Datatypes and Operators in Java/22075102-Relational-Operators-in-Java.pdf

40.6 KB
 

Showing first 3 matched files of 602 total files

Sanket Singh - Learn Backend In NodeJS From Scratch

19.3 GB

/1. Introduction to Programming with JS [Recorded]/09. Relational Operators.mp4

63.9 MB
 

Showing first 1 matched files of 98 total files

Cyndi Dale - Your Energetic Boundaries

188.4 MB

/07 - Relational boundaries.mp3

3.1 MB

/41 - Healthy vs. unhealthy relational boundaries.mp3

5.2 MB

/42 - Meditation Healing Relational Boundaries.mp3

17.5 MB
 

Showing first 3 matched files of 48 total files
«« « Back Next » »»

Copyright © 2025 FileMood.com