FileMood

Showing results 40 to 59 of about 257 for elasticache

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/23. ElastiCache Overview.mp4

11.7 MB

/3. Domain 2 Storage/23. ElastiCache Overview.srt

3.8 KB
 

Showing first 2 matched files of 612 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/9. Elasticache.mp4

23.2 MB

/5. Databases On AWS/9. Elasticache.srt

5.2 KB
 

Showing first 2 matched files of 696 total files

UD1

5.3 GB

/03 Domain 2 Storage/046 ElastiCache Overview.mp4

11.7 MB
 

Showing first 1 matched files of 138 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB
 

Showing first 1 matched files of 135 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.mp4

44.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/10. Amazon Elasticache Scenario Based Questions set # 3.srt

21.9 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.mp4

34.5 MB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/3. Amazon Elasticache Introduction.srt

18.6 KB

/28. AWS Caching, Big Data, Data Streaming, Analytics, and IoT Services/4. Amazon ElastiCache - Caching Strategies.mp4

12.8 MB
 

Showing first 5 matched files of 1023 total files

UD151

11.5 GB

/11 Databases/187 Amazon ElastiCache Overview.mp4

33.8 MB

/11 Databases/188 Create Amazon ElastiCache Memcached Cluster.mp4

36.6 MB

/11 Databases/189 Create Amazon ElastiCache Redis Cluster.mp4

56.2 MB

/11 Databases/190 ElastiCache Redis AUTH.mp4

7.4 MB

/11 Databases/193 Exam Cram - Aurora DynamoDB ElastiCache and RedShift.mp4

61.2 MB
 

Showing first 5 matched files of 275 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2021

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB
 

Showing first 1 matched files of 135 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner 2020

9.1 GB

/2. Understanding Core AWS Services/68. AWS ElastiCache.mp4

69.9 MB
 

Showing first 1 matched files of 135 total files

Anirban Saha - Salt Cookbook - 2015

1.8 MB

/Code/cookbook/chapter09/05_elasticache_clusters/elasticache.sls

0.3 KB
 

Showing first 1 matched files of 89 total files

[OTUS] AWS для разработчиков (Часть 1-3) (2020)

5.5 GB

/15 ElastiCache/cloud_lec_DBS2.pptx

365.6 KB

/15 ElastiCache/zoom.mp4

55.9 MB
 

Showing first 2 matched files of 58 total files

UD610

3.6 GB

/aws-certified-cloud-practitioner-new/09 Databases Analytics/085 ElastiCache Overview.mp4

8.1 MB
 

Showing first 1 matched files of 196 total files

[FTUForum.com] [UDEMY] COMPLETE- AWS Developer Certification [FTU]

3.2 GB

/8. Cloud Database/4. Elasticache.mp4

76.3 MB

/8. Cloud Database/4. Elasticache.vtt

10.6 KB

/8. Cloud Database/5. Create an Instance Elasticache.mp4

25.1 MB

/8. Cloud Database/5. Create an Instance Elasticache.vtt

3.5 KB
 

Showing first 4 matched files of 145 total files

LA630

6.7 GB

/64. Elasticache.mp4

13.0 MB
 

Showing first 1 matched files of 140 total files

[ FreeCourseWeb ] Udemy - COMPLETE- AWS Developer Certification

3.2 GB

/~Get Your Course Here !/8. Cloud Database/4. Elasticache.mp4

76.3 MB

/~Get Your Course Here !/8. Cloud Database/4. Elasticache.vtt

10.6 KB

/~Get Your Course Here !/8. Cloud Database/5. Create an Instance Elasticache.mp4

25.1 MB

/~Get Your Course Here !/8. Cloud Database/5. Create an Instance Elasticache.vtt

3.5 KB
 

Showing first 4 matched files of 142 total files

ACG77

3.7 GB

/05 Databases On AWS/008 DOC AWS Elasticache.txt

0.1 KB

/05 Databases On AWS/008 Elasticache.mp4

13.0 MB
 

Showing first 2 matched files of 182 total files

[FreeCourseWeb] Udemy - Serverless Computing with AWS LAMBDA- FaaS

1.9 GB

/07 Exploring AWS Database Services/025 Elasticache.mp4

90.7 MB
 

Showing first 1 matched files of 45 total files

UD609

3.5 GB

/aws-solutions-architect-professional/07 Caching/050 Amazon ElastiCache.mp4

23.2 MB
 

Showing first 1 matched files of 134 total files

UD673

23.8 GB

/aws-essentials-solutions-architect-assoc-the-total-course/18 Solutions Architect Chapter 14 - Additional AWS Services/159 ElastiCache.mp4

95.4 MB
 

Showing first 1 matched files of 197 total files

TCB1

8.4 GB

/00230 - [202007Update] [NEW] Elasticache.mp4

33.7 MB
 

Showing first 1 matched files of 233 total files

OR181

1.1 GB

/09 - Elasticache.mp4

13.9 MB
 

Showing first 1 matched files of 24 total files
«« « Back Next » »»

Copyright © 2025 FileMood.com