|
41.0 GB |
||
/3. Визуализация вируса/5. Настройка света и материалов в Redshift.mp4 |
177.0 MB |
|
186.2 MB |
|
79.1 MB |
Showing first 3 matched files of 138 total files |
|
16.2 GB |
||
/Audiomachine - Volturnus (2018) [24B-48kHz]/02. Redshift.flac |
46.4 MB |
Showing first 1 matched files of 527 total files |
[ DevCourseWeb.com ] Linkedin - Kubernetes - Provisioning for Infrastructure as Code |
2/1 |
1.8 GB |
|
|
17.6 KB |
|
2.3 KB |
|
4.8 KB |
|
0.8 KB |
|
10.3 KB |
Showing first 5 matched files of 844 total files |
[ DevCourseWeb.com ] AWS Certified Solutions Architect Associate WARP 9 |
0/1 |
1.5 GB |
|
|
17.1 MB |
|
6.3 KB |
Showing first 2 matched files of 220 total files |
8/1 |
503.5 MB |
||
|
83.4 KB |
|
668.8 KB |
|
373.3 KB |
/Papers/Loeb, Avi - Detectability of Local Group Dwarf Galaxy Analogues at High Redshifts (2015).pdf |
357.1 KB |
|
265.7 KB |
Showing first 5 matched files of 421 total files |
|
7.0 GB |
||
|
23.8 MB |
Showing first 1 matched files of 335 total files |
|
104.0 MB |
||
|
2.6 MB |
Showing first 1 matched files of 409 total files |
1/0 |
130.1 MB |
||
|
13.4 MB |
Showing first 1 matched files of 11 total files |
11/1 |
8.7 GB |
||
|
21.9 KB |
|
21.6 KB |
|
21.3 KB |
|
21.2 KB |
|
20.9 KB |
Showing first 5 matched files of 1268 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/4. Domain 3 Processing/17. Spark Integration with Kinesis and Redshift.mp4 |
21.0 MB |
/4. Domain 3 Processing/17. Spark Integration with Kinesis and Redshift.srt |
6.3 KB |
/6. Domain 4 Analysis/17. Redshift Intro and Architecture.mp4 |
51.9 MB |
/6. Domain 4 Analysis/17. Redshift Intro and Architecture.srt |
14.1 KB |
/6. Domain 4 Analysis/18. Redshift Spectrum and Performance Tuning.mp4 |
39.2 MB |
Showing first 5 matched files of 612 total files |
[ CourseBoat.com ] helloluxx - learn. Houdini. In Bloom with Rich Nosworthy |
|
1.2 GB |
|
/~Get Your Files Here !/learn. Houdini. In Bloom-Chapter22_ExportingRedshiftProxies-1080P .flv |
45.9 MB |
Showing first 1 matched files of 34 total files |
[ DevCourseWeb.com ] Udemy - Aws Certified Cloud Practitioner + Practice Exams (2022) |
1/0 |
3.5 GB |
|
/~Get Your Files Here !/11 - Managed Databases on AWS/116 - Amazon Redshift.mp4 |
10.3 MB |
Showing first 1 matched files of 245 total files |
7/2 |
19.0 GB |
||
|
38.5 MB |
/Live/2006 - Satriani Live! (2CD)/CD1/01 - Redshift Riders [Live Album Version].flac |
38.0 MB |
Showing first 2 matched files of 777 total files |
|
4.4 GB |
||
|
44.1 MB |
Showing first 1 matched files of 42 total files |
|
2.3 GB |
||
/Megas--Lunaire-GFR069-WEB-2022-BABAS/05-megas--redshift-ece939bc.mp3 |
8.5 MB |
Showing first 1 matched files of 261 total files |
|
39.9 GB |
||
/Week 4/render/explosion_file_pyro_expl_REBELWAY.Redshift_ROP1.0043.exr |
985.9 KB |
Showing first 1 matched files of 337 total files |
|
964.8 MB |
||
|
672.4 MB |
|
0.1 KB |
Showing first 2 matched files of 5 total files |
desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009 |
|
9.6 GB |
|
|
72.6 MB |
|
9.7 KB |
Showing first 2 matched files of 696 total files |
|
7.9 GB |
||
|
1.1 GB |
|
1.1 GB |
|
1.1 GB |
|
1.1 GB |
|
1.1 GB |
Showing first 5 matched files of 8 total files |
|
8.3 GB |
||
|
1.0 GB |
|
1.0 GB |
|
1.0 GB |
|
1.0 GB |
|
1.0 GB |
Showing first 5 matched files of 9 total files |
Copyright © 2024 FileMood.com