Desirecourse netudemyawscertifieddataanalyticsspecialty2020exbigdata |
||
Domain Analysis 18 Redshift Spectrum and Performance Tuning mp4 |
Name |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
DOWNLOAD
Copy Link
Trouble downloading? see How To |
Total Size |
6.7 GB |
|
Total Files |
612 |
|
Hash |
07E7A0665C6F5E503F6139889A05E32D09876CD0 |
/6. Domain 4 Analysis/18. Redshift Spectrum and Performance Tuning.mp4 |
39.2 MB |
/6. Domain 4 Analysis/18. Redshift Spectrum and Performance Tuning.srt |
8.0 KB |
/6. Domain 4 Analysis/17. Redshift Intro and Architecture.mp4 |
51.9 MB |
/6. Domain 4 Analysis/17. Redshift Intro and Architecture.srt |
14.1 KB |
/6. Domain 4 Analysis/19. Redshift Durability and Scaling.mp4 |
31.0 MB |
/6. Domain 4 Analysis/19. Redshift Durability and Scaling.srt |
6.4 KB |
|
12.7 MB |
/6. Domain 4 Analysis/22. Redshift Data Flows and the COPY command.mp4 |
62.6 MB |
|
27.7 MB |
|
4.9 KB |
/6. Domain 4 Analysis/22. Redshift Data Flows and the COPY command.srt |
13.1 KB |
|
30.3 MB |
|
5.4 KB |
/6. Domain 4 Analysis/15. [Exercise] AWS Glue and Athena.mp4 |
78.4 MB |
/6. Domain 4 Analysis/25. [Exercise] Redshift Spectrum, Pt. 1.mp4 |
57.7 MB |
Showing first 15 files of 612 total files |
Copyright © 2025 FileMood.com