|
790.6 MB |
||
[ CoursePig.com ] Udemy - Professional Bitcoin Trading & Mining Course (Fast & Simple) |
|
1.4 GB |
|
/~Get Your Files Here !/4. Technical Analysis/2. Introduction to Charts & Time Frames.mp4 |
93.9 MB |
/~Get Your Files Here !/4. Technical Analysis/2. Introduction to Charts & Time Frames.srt |
11.2 KB |
Showing first 2 matched files of 68 total files |
|
2.5 GB |
||
|
4.0 KB |
|
13.8 MB |
Showing first 2 matched files of 282 total files |
|
24.8 GB |
||
|
7.1 MB |
Showing first 1 matched files of 3149 total files |
|
234.4 MB |
||
|
816.0 MB |
||
[ DevCourseWeb.com ] Udemy - Getting Started In Asana - Asana Course For Beginners |
|
451.9 MB |
|
|
5.1 KB |
/~Get Your Files Here !/4 - Go Further/12 - Timeline a Gantt Chart View for Your Projects.mp4 |
17.0 MB |
Showing first 2 matched files of 48 total files |
Billboard Global 200 Singles Chart (07-October-2023) Mp3 320kbps [PMEDIA] ⭐️ |
|
1.7 GB |
|
|
783.9 MB |
||
|
1.7 GB |
||
|
304.9 MB |
||
|
709.6 MB |
||
|
795.9 MB |
||
podcast_charts-francenet-lalbum_james-morrison-avec-the-awake_1000101266815 |
|
5.8 MB |
|
|
796.9 MB |
||
|
1.4 MB |
|
617.3 KB |
Showing first 2 matched files of 747 total files |
Drake Surach - ChatGTP Mastery Course (www.imarketing.courses) |
|
7.6 GB |
|
|
112.8 MB |
|
262.0 KB |
|
50.4 KB |
Showing first 3 matched files of 86 total files |
|
798.0 MB |
||
Adobe Substance 3D Sampler v4.1.2.3298 (x64) + Fix {CracksHash} |
|
1.9 GB |
|
|
0.9 KB |
|
0.5 KB |
|
0.5 KB |
|
0.6 KB |
|
0.5 KB |
Showing first 5 matched files of 4936 total files |
Crem Road records collection - 20210905 Edition - Creative Commons |
|
35.6 GB |
|
|
1.7 MB |
/Nicolas_Chartoire-2009-Dob_Beizy-01-Somethin-Creative_Commons_by-nc-nd_2.0_fr.flac |
8.0 MB |
|
10.0 MB |
/Nicolas_Chartoire-2009-Dob_Beizy-03-I_Am_Waiting_For_You-Creative_Commons_by-nc-nd_2.0_fr.flac |
8.9 MB |
/Nicolas_Chartoire-2009-Dob_Beizy-04-Stand_The_Shifters-Creative_Commons_by-nc-nd_2.0_fr.flac |
11.2 MB |
Showing first 5 matched files of 938 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/7. Domain 5 Visualization/7. Other Visualization Tools (HighCharts, D3, etc).mp4 |
19.8 MB |
/7. Domain 5 Visualization/7. Other Visualization Tools (HighCharts, D3, etc).srt |
4.5 KB |
Showing first 2 matched files of 612 total files |
Copyright © 2025 FileMood.com