|
|
1.5 GB |
||
|
|
14.2 MB |
|
Showing first 1 matched files of 101 total files |
|
|
|
8.1 GB |
||
|
Various Artists - Mastermix Crate vol 023 (70s Funk) (2022) Mp3 320kbps [PMEDIA] ⭐️ |
|
194.2 MB |
|
|
|
11.8 MB |
|
Showing first 1 matched files of 21 total files |
|
|
[ DevCourseWeb.com ] Distributed Databases with Apache Ignite |
|
233.5 MB |
|
|
~Get Your Files Here !/01 - Introduction/01 - Overview of Apache Ignite.mp4 |
7.1 MB |
|
~Get Your Files Here !/01 - Introduction/01 - Overview of Apache Ignite.srt |
7.3 KB |
|
|
6.3 MB |
|
|
6.5 KB |
|
~Get Your Files Here !/02 - 1. Getting Started with Apache Ignite/02 - The Ignite data model.mp4 |
4.8 MB |
|
Showing first 5 matched files of 94 total files |
|
|
|
1.6 GB |
||
|
|
1.6 GB |
|
|
3.4 KB |
|
|
83.3 KB |
|
3 matched files |
|
|
|
1.6 GB |
||
|
|
36.5 GB |
||
|
|
11.6 KB |
|
Showing first 1 matched files of 122 total files |
|
|
|
36.6 GB |
||
|
|
11.6 KB |
|
Showing first 1 matched files of 290 total files |
|
|
|
64.7 GB |
||
|
ARMORED CORE VI FIRES OF RUBICON/Game/EasyAntiCheat/licenses/apache-2.0.txt |
11.6 KB |
|
Showing first 1 matched files of 545 total files |
|
|
|
36.7 GB |
||
|
|
11.6 KB |
|
Showing first 1 matched files of 119 total files |
|
|
VA - Dance Classics (Classics, Gold, Pop Edition1988-2013)(VLAD-DVA) MP3 |
|
25.0 GB |
|
|
|
14.9 MB |
|
Showing first 1 matched files of 2046 total files |
|
|
|
64.7 GB |
||
|
ARMORED CORE VI FIRES OF RUBICON/Game/EasyAntiCheat/licenses/apache-2.0.txt |
11.6 KB |
|
Showing first 1 matched files of 545 total files |
|
|
|
53.1 GB |
||
|
2019 - Future Trance Vol. 87/CD1/11. Wolfpack & Eastblock Bitches - Apache Anthem.mp3 |
6.9 MB |
|
2006 - Future Trance Vol. 35/CD1/08. Scooter - Apache Rocks the Bottom.mp3 |
9.1 MB |
|
Showing first 2 matched files of 6099 total files |
|
|
|
13.9 GB |
||
|
Sniper Ghost Warrior Contracts/EasyAntiCheat/Licenses/Apache-2.0.txt |
11.6 KB |
|
Showing first 1 matched files of 219 total files |
|
|
VA - NOW That's What I Call Music! 1993 The Millennium Series (2CD) - 1999 (flac) |
|
1.0 GB |
|
|
|
26.6 MB |
|
Showing first 1 matched files of 41 total files |
|
|
|
54.5 GB |
||
|
|
11.6 KB |
|
Showing first 1 matched files of 503 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.mp4 |
47.3 MB |
|
2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.srt |
15.9 KB |
|
|
29.8 MB |
|
|
10.7 KB |
|
Showing first 4 matched files of 612 total files |
|
|
|
22.6 GB |
||
|
|
216.6 MB |
|
|
256.1 MB |
|
Showing first 2 matched files of 186 total files |
|
|
|
3.2 GB |
||
|
|
3.3 KB |
|
Showing first 1 matched files of 4772 total files |
|
|
|
348.1 MB |
||
|
|
7.1 MB |
|
Showing first 1 matched files of 50 total files |
|
Copyright © 2026 FileMood.com