FileMood

Showing results 644 to 663 of about 3829 for kafka

Sayo Momo - Kafka Latex bunny.zip

394.6 MB

[MeriolChan] Kafka [2699699].zip

249.8 MB

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.mp4

47.3 MB

/2. Domain 1 Collection/21. MSK Managed Streaming for Apache Kafka.srt

15.9 KB
 

Showing first 2 matched files of 612 total files

Franz Kafka-Metamorfoza

163.3 MB

[Sakamoto Kafka] Kourin! Akuma Friends - Advent! Devil Friends [Digital]

125.7 MB

KuukoW - Kafka (Honkai Star Rail) (July 2023).zip

105.0 MB

[ DevCourseWeb.com ] Udemy - Event-Driven Microservices - Spring Boot, Kafka and Elastic

4.0 GB

/~Get Your Files Here !/10/001 Introduction to Kafka streams.mp4

10.8 MB

/~Get Your Files Here !/10/001 Introduction to Kafka streams_en.srt

3.0 KB

/~Get Your Files Here !/10/002 Kafka streams microservice base project.mp4

17.2 MB

/~Get Your Files Here !/10/002 Kafka streams microservice base project_en.srt

7.0 KB

/~Get Your Files Here !/10/003 Completing the Kafka streams microservice.mp4

33.8 MB
 

Showing first 5 matched files of 3550 total files

[阪本KAFKA] 調教!ラプホ女子会（COMICグーチョ vol.15） [中国翻訳].zip

16.4 MB

[Tutorialsplanet.NET] Udemy - Microservices Clean Architecture, DDD, SAGA, Outbox & Kafka

12.2 GB

/10 - CQRS Architecture Pattern/92 - Creating Customer Kafka topic Customer modules Arabic.vtt

16.8 KB

/10 - CQRS Architecture Pattern/92 - Creating Customer Kafka topic Customer modules Bengali.vtt

25.6 KB

/10 - CQRS Architecture Pattern/92 - Creating Customer Kafka topic Customer modules Dutch.vtt

13.6 KB

/10 - CQRS Architecture Pattern/92 - Creating Customer Kafka topic Customer modules English.vtt

14.4 KB

/10 - CQRS Architecture Pattern/92 - Creating Customer Kafka topic Customer modules French.vtt

14.6 KB
 

Showing first 5 matched files of 2509 total files

tutsgalaxy.-net-udemy-learn-dev-ops-the-complete-kubernetes-course

4.4 GB

/7. Serverless on Kubernetes/4. Demo Triggering Kubeless Functions with Kafka.mp4

94.4 MB

/7. Serverless on Kubernetes/4. Demo Triggering Kubeless Functions with Kafka.vtt

13.1 KB
 

Showing first 2 matched files of 532 total files

Severals - Algorithm (2022) [FLAC]

275.5 MB

/09. Kafkaesque (feat. Sinizter).flac

30.2 MB
 

Showing first 1 matched files of 13 total files

[ CourseMega.com ] Kafka Connect (Fourth Early Release)

4.2 MB

/~Get Your Files Here !/Kafka Connect.epub

2.0 MB

/~Get Your Files Here !/Kafka Connect.pdf

2.2 MB
 

Showing first 2 matched files of 4 total files

[adn]_Kafka_Inaka_Isha_[DVD][F4D51D2E].mkv

469.4 MB

The Techno Streaming Sound Vol.02

1.4 GB

/024. Donato Dozzy - Messy Kafka World.mp3

12.9 MB
 

Showing first 1 matched files of 101 total files

Love That Feeling

1.9 GB

/061. Ercos Blanka - Kafka.mp3

23.9 MB
 

Showing first 1 matched files of 121 total files

SesliE-Kitap

1.4 GB

/FranzKafka-Donusum-OkanBayulgen.mp3

305.2 MB

/FranzKafka-Donusum-OkanBayulgen.ogg

80.5 MB

/FranzKafka-Donusum-OkanBayulgen.png

6.7 KB

/FranzKafka-Donusum-OkanBayulgen_spectrogram.png

213.6 KB
 

Showing first 4 matched files of 61 total files

Книжная серия Для профессионалов

1.9 GB

/Беджек Б. - Kafka Streams в действии - 2019.pdf

25.4 MB
 

Showing first 1 matched files of 75 total files

Elias_Canetti

6.4 MB

/Kanetti_Drugoi_process_Franc_Kafka_v_pismah_k_Felice.fb2

396.2 KB
 

Showing first 1 matched files of 5 total files

CarneApaleadaF30XaKafka_201611

2.2 GB

/Carne Apaleada f30 xa Kafka.avi

1.2 GB

/Carne Apaleada f30 xa Kafka.mp4

588.1 MB

/Carne Apaleada f30 xa Kafka.ogv

429.4 MB

/CarneApaleadaF30XaKafka_201611_meta.sqlite

9.2 KB

/CarneApaleadaF30XaKafka_201611_meta.xml

0.7 KB
 

Showing first 5 matched files of 12 total files

Breaking Bad S03-1080p Movies-daily.com

8.7 GB

/Breaking.Bad.S03E09.Kafkaesque.1080p.10bit.BluRay.x265.mkv

688.8 MB
 

Showing first 1 matched files of 13 total files
«« « Back Next » »»

Copyright © 2025 FileMood.com