FileMood

Showing results 693 to 712 of about 3365 for classification

[ CourseHulu.com ] Udemy - Biochemistry - Learn Amino Acid And Protein Basics

1.1 GB

/~Get Your Files Here !/2 - Amino acid properites/3 - Classification.mp4

85.1 MB

 

Showing first 1 matched files of 34 total files

[ DevCourseWeb.com ] Udemy - Machine learning model evaluation in Python

440.8 MB

/~Get Your Files Here !/03 - Evaluation of binary classification models/001 Binary classification performance metrics.mp4

84.6 MB

/~Get Your Files Here !/03 - Evaluation of binary classification models/001 Binary classification performance metrics_en.srt

15.9 KB

/~Get Your Files Here !/03 - Evaluation of binary classification models/002 Binary classification performance metrics in Python.mp4

45.0 MB

/~Get Your Files Here !/03 - Evaluation of binary classification models/002 Binary classification performance metrics in Python_en.srt

10.3 KB

/~Get Your Files Here !/03 - Evaluation of binary classification models/002 Binary-classification-metrics.ipynb

5.6 KB

 

Showing first 5 matched files of 28 total files

[ FreeCourseWeb.com ] Electrical Engineering (2023)

2.0 GB

/~Get Your Files Here !/2. The Course Contents/9. The Voltages Classification.mp4

24.6 MB

 

Showing first 1 matched files of 38 total files

CCNP and CCIE Enterprise Core ENCOR 350-401, 2nd Edition

7.2 GB

/Lesson 13 Quality of Service (QoS)/005. 13.4 Classification and Marking.mp4

65.3 MB

 

Showing first 1 matched files of 210 total files

[ TutSala.com ] Udemy - How To Start And Run Your Delaware Company

296.7 MB

/~Get Your Files Here !/3 - Tax Issues/4 - Overview of US tax classification of foreign businesses English.vtt

8.6 KB

/~Get Your Files Here !/3 - Tax Issues/4 - Overview of US tax classification of foreign businesses.mp4

49.6 MB

 

Showing first 2 matched files of 18 total files

[ DevCourseWeb.com ] Udemy - Quality Assurance Mastery - Learn ETL Testing from Scratch

2.3 GB

/~Get Your Files Here !/08 - What is Responsive Testing/004 Testing Types Classification.mp4

12.2 MB

/~Get Your Files Here !/08 - What is Responsive Testing/004 Testing Types Classification_en.vtt

3.6 KB

 

Showing first 2 matched files of 94 total files

[ TutSala.com ] Udemy - Main Unit Operations in Chemical Engineering

1.6 GB

/~Get Your Files Here !/02 - Pump Unit Operation/001 Classification of Pumps.mp4

12.9 MB

/~Get Your Files Here !/02 - Pump Unit Operation/001 Classification of Pumps_en.srt

1.6 KB

 

Showing first 2 matched files of 100 total files

[ FreeCourseWeb.com ] Heart Of Ai - A Theoretical Odyssey On Machine Learning

1.6 GB

/~Get Your Files Here !/8 - Advanced Topics in Machine Learning/44 - Image Classification and Object Detection.mp4

40.6 MB

 

Showing first 1 matched files of 55 total files

office-of-film-and-literature-classification_0901846.000

813.6 KB

/office-of-film-and-literature-classification_0901846.000_meta.sqlite

17.4 KB

/office-of-film-and-literature-classification_0901846.000_meta.xml

4.7 KB

 

Showing first 2 matched files of 9 total files

office-of-film-and-literature-classification_1600118.001

196.0 KB

/office-of-film-and-literature-classification_1600118.001_meta.sqlite

14.3 KB

/office-of-film-and-literature-classification_1600118.001_meta.xml

2.9 KB

 

Showing first 2 matched files of 9 total files

office-of-film-and-literature-classification_9600122

491.6 KB

/office-of-film-and-literature-classification_9600122_meta.sqlite

15.4 KB

/office-of-film-and-literature-classification_9600122_meta.xml

3.4 KB

 

Showing first 2 matched files of 9 total files

office-of-film-and-literature-classification_1800603.011

579.6 KB

/office-of-film-and-literature-classification_1800603.011_meta.sqlite

15.4 KB

/office-of-film-and-literature-classification_1800603.011_meta.xml

3.3 KB

 

Showing first 2 matched files of 9 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/5. Machine Learning AWS Certified Big Data exam only!/3. Classification Models.mp4

49.5 MB

/5. Machine Learning AWS Certified Big Data exam only!/3. Classification Models.srt

11.4 KB

 

Showing first 2 matched files of 612 total files

office-of-film-and-literature-classification_0802498.011

595.6 KB

/office-of-film-and-literature-classification_0802498.011_meta.sqlite

14.3 KB

/office-of-film-and-literature-classification_0802498.011_meta.xml

3.2 KB

 

Showing first 2 matched files of 9 total files

[ TutSala.com ] Udemy - Tank Farm Layout and Stress Analysis

1.1 GB

/~Get Your Files Here !/02 - Definitions and Classifications/001 Classification & Types.mp4

112.7 MB

/~Get Your Files Here !/02 - Definitions and Classifications/001 Classification & Types_en.vtt

13.1 KB

 

Showing first 2 matched files of 20 total files

[ TutGee.com ] Desktop Support IT Support IT Fundamentals Training Course (2021)

1.9 GB

/~Get Your Files Here !/4. What is Computer Network/2. What is classification of computer network.mp4

28.4 MB

/~Get Your Files Here !/4. What is Computer Network/2. What is classification of computer network.srt

3.5 KB

/~Get Your Files Here !/6. What is Computer/3. What is Classification of Memory.mp4

54.9 MB

/~Get Your Files Here !/6. What is Computer/3. What is Classification of Memory.srt

3.7 KB

 

Showing first 4 matched files of 58 total files

[ TutGee.com ] Udemy - Marketing Management Masterclass - 13 In 1 Mba Level Course

2.7 GB

/~Get Your Files Here !/12 - Place Marketing Channels/102 - Classification of Marketing Channel Intermediaries English.srt

1.4 KB

/~Get Your Files Here !/12 - Place Marketing Channels/102 - Classification of Marketing Channel Intermediaries.mp4

4.7 MB

/~Get Your Files Here !/5 - Demand Forecasting/42 - Classification of Market Size English.srt

3.4 KB

/~Get Your Files Here !/5 - Demand Forecasting/42 - Classification of Market Size.mp4

15.4 MB

 

Showing first 4 matched files of 244 total files

free-tutorials-us.com-udemy-machine-learning-a-z-become-kaggle-master

16.8 GB

/13. KNN/1. Introduction to Classification.mp4

56.7 MB

/13. KNN/1. Introduction to Classification.vtt

15.9 KB

/13. KNN/11. Classification Case1.mp4

88.3 MB

/13. KNN/11. Classification Case1.vtt

25.6 KB

/13. KNN/12. Classification Case2.mp4

54.8 MB

 

Showing first 5 matched files of 1122 total files

[ TutPig.com ] Udemy - Dental LASERs - Another Point of View

909.4 MB

/~Get Your Files Here !/04 - Classifications Of LASERs From Many Points of View/001 Classifications Of LASERs From Many Points of View.mp4

75.1 MB

/~Get Your Files Here !/04 - Classifications Of LASERs From Many Points of View/001 Classifications Of LASERs From Many Points of View_en.vtt

3.7 KB

/~Get Your Files Here !/04 - Classifications Of LASERs From Many Points of View/002 Classifications Of LASERs From Many Points of View.mp4

154.1 MB

/~Get Your Files Here !/04 - Classifications Of LASERs From Many Points of View/002 Classifications Of LASERs From Many Points of View_en.vtt

8.0 KB

/~Get Your Files Here !/05 - MOHSEN 'S Classification, Famous Wavelengths that Used in Dentistry & Initiation/001 MOHSEN 'S Classification, Famous Wavelengths that Used in Dentistry & Initiation.mp4

163.1 MB

 

Showing first 5 matched files of 16 total files

[CourseClub.Me] SkillShare - Data Science and Business Analytics with Python

3.3 GB

/25. Machine Learning Classification.mp4

125.0 MB

/25. Machine Learning Classification.srt

11.7 KB

 

Showing first 2 matched files of 76 total files


Copyright © 2025 FileMood.com