|
[ CourseHulu.com ] Udemy - Biochemistry - Learn Amino Acid And Protein Basics |
|
1.1 GB |
|
|
/~Get Your Files Here !/2 - Amino acid properites/3 - Classification.mp4 |
85.1 MB |
|
Showing first 1 matched files of 34 total files |
|
|
[ DevCourseWeb.com ] Udemy - Machine learning model evaluation in Python |
|
440.8 MB |
|
|
|
84.6 MB |
|
|
15.9 KB |
|
|
45.0 MB |
|
|
10.3 KB |
|
|
5.6 KB |
|
Showing first 5 matched files of 28 total files |
|
|
|
2.0 GB |
||
|
/~Get Your Files Here !/2. The Course Contents/9. The Voltages Classification.mp4 |
24.6 MB |
|
Showing first 1 matched files of 38 total files |
|
|
|
7.2 GB |
||
|
/Lesson 13 Quality of Service (QoS)/005. 13.4 Classification and Marking.mp4 |
65.3 MB |
|
Showing first 1 matched files of 210 total files |
|
|
[ TutSala.com ] Udemy - How To Start And Run Your Delaware Company |
|
296.7 MB |
|
|
|
8.6 KB |
|
|
49.6 MB |
|
Showing first 2 matched files of 18 total files |
|
|
[ DevCourseWeb.com ] Udemy - Quality Assurance Mastery - Learn ETL Testing from Scratch |
|
2.3 GB |
|
|
/~Get Your Files Here !/08 - What is Responsive Testing/004 Testing Types Classification.mp4 |
12.2 MB |
|
/~Get Your Files Here !/08 - What is Responsive Testing/004 Testing Types Classification_en.vtt |
3.6 KB |
|
Showing first 2 matched files of 94 total files |
|
|
[ TutSala.com ] Udemy - Main Unit Operations in Chemical Engineering |
|
1.6 GB |
|
|
/~Get Your Files Here !/02 - Pump Unit Operation/001 Classification of Pumps.mp4 |
12.9 MB |
|
/~Get Your Files Here !/02 - Pump Unit Operation/001 Classification of Pumps_en.srt |
1.6 KB |
|
Showing first 2 matched files of 100 total files |
|
|
[ FreeCourseWeb.com ] Heart Of Ai - A Theoretical Odyssey On Machine Learning |
|
1.6 GB |
|
|
|
40.6 MB |
|
Showing first 1 matched files of 55 total files |
|
|
|
813.6 KB |
||
|
/office-of-film-and-literature-classification_0901846.000_meta.sqlite |
17.4 KB |
|
/office-of-film-and-literature-classification_0901846.000_meta.xml |
4.7 KB |
|
Showing first 2 matched files of 9 total files |
|
|
|
196.0 KB |
||
|
/office-of-film-and-literature-classification_1600118.001_meta.sqlite |
14.3 KB |
|
/office-of-film-and-literature-classification_1600118.001_meta.xml |
2.9 KB |
|
Showing first 2 matched files of 9 total files |
|
|
|
491.6 KB |
||
|
/office-of-film-and-literature-classification_9600122_meta.sqlite |
15.4 KB |
|
/office-of-film-and-literature-classification_9600122_meta.xml |
3.4 KB |
|
Showing first 2 matched files of 9 total files |
|
|
|
579.6 KB |
||
|
/office-of-film-and-literature-classification_1800603.011_meta.sqlite |
15.4 KB |
|
/office-of-film-and-literature-classification_1800603.011_meta.xml |
3.3 KB |
|
Showing first 2 matched files of 9 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
/5. Machine Learning AWS Certified Big Data exam only!/3. Classification Models.mp4 |
49.5 MB |
|
/5. Machine Learning AWS Certified Big Data exam only!/3. Classification Models.srt |
11.4 KB |
|
Showing first 2 matched files of 612 total files |
|
|
|
595.6 KB |
||
|
/office-of-film-and-literature-classification_0802498.011_meta.sqlite |
14.3 KB |
|
/office-of-film-and-literature-classification_0802498.011_meta.xml |
3.2 KB |
|
Showing first 2 matched files of 9 total files |
|
|
[ TutSala.com ] Udemy - Tank Farm Layout and Stress Analysis |
|
1.1 GB |
|
|
/~Get Your Files Here !/02 - Definitions and Classifications/001 Classification & Types.mp4 |
112.7 MB |
|
/~Get Your Files Here !/02 - Definitions and Classifications/001 Classification & Types_en.vtt |
13.1 KB |
|
Showing first 2 matched files of 20 total files |
|
|
[ TutGee.com ] Desktop Support IT Support IT Fundamentals Training Course (2021) |
|
1.9 GB |
|
|
|
28.4 MB |
|
|
3.5 KB |
|
/~Get Your Files Here !/6. What is Computer/3. What is Classification of Memory.mp4 |
54.9 MB |
|
/~Get Your Files Here !/6. What is Computer/3. What is Classification of Memory.srt |
3.7 KB |
|
Showing first 4 matched files of 58 total files |
|
|
[ TutGee.com ] Udemy - Marketing Management Masterclass - 13 In 1 Mba Level Course |
|
2.7 GB |
|
|
|
1.4 KB |
|
|
4.7 MB |
|
/~Get Your Files Here !/5 - Demand Forecasting/42 - Classification of Market Size English.srt |
3.4 KB |
|
/~Get Your Files Here !/5 - Demand Forecasting/42 - Classification of Market Size.mp4 |
15.4 MB |
|
Showing first 4 matched files of 244 total files |
|
|
free-tutorials-us.com-udemy-machine-learning-a-z-become-kaggle-master |
|
16.8 GB |
|
|
|
56.7 MB |
|
|
15.9 KB |
|
|
88.3 MB |
|
|
25.6 KB |
|
|
54.8 MB |
|
Showing first 5 matched files of 1122 total files |
|
|
[ TutPig.com ] Udemy - Dental LASERs - Another Point of View |
|
909.4 MB |
|
|
|
75.1 MB |
|
|
3.7 KB |
|
|
154.1 MB |
|
|
8.0 KB |
|
|
163.1 MB |
|
Showing first 5 matched files of 16 total files |
|
|
[CourseClub.Me] SkillShare - Data Science and Business Analytics with Python |
|
3.3 GB |
|
|
|
125.0 MB |
|
|
11.7 KB |
|
Showing first 2 matched files of 76 total files |
|
Copyright © 2025 FileMood.com