dynamodb | 80 to 99 | Download files with FileMood

Welcome Guest
Log In
Register

Showing results 80 to 99 of about 467 for dynamodb

[ CoursePig.com ] Udemy - Learn MuleSoft with AWS - a Guide to Hybrid Integration Model		2.7 GB	DOWNLOAD

/~Get Your Files Here !/5. Amazon DynamoDB Connector/1. What is Amazon DynamoDB.mp4	19.5 MB
/~Get Your Files Here !/5. Amazon DynamoDB Connector/1. What is Amazon DynamoDB.srt	2.2 KB
/~Get Your Files Here !/5. Amazon DynamoDB Connector/10. Update Items in Amazon DynamoDB Table.mp4	106.4 MB
/~Get Your Files Here !/5. Amazon DynamoDB Connector/10. Update Items in Amazon DynamoDB Table.srt	7.3 KB
/~Get Your Files Here !/5. Amazon DynamoDB Connector/11. Delete Items in Amazon DynamoDB Table.mp4	57.6 MB
Showing first 5 matched files of 105 total files

PacktPub - AWS Certified Cloud Practitioner (CLF-C01)		2.9 GB	DOWNLOAD

/6.AWS Database Services/52.Section 6-3 Amazon Aurora DynamoDB Redshift and ElastiCache.mp4	35.1 MB
Showing first 1 matched files of 92 total files

GetFreeCourses.Co-Udemy-AWS Lambda and the Serverless Framework - Hands On Learning!		5.5 GB	DOWNLOAD

/10 - [Hands-on] - Real World Example Service - 1 - Thumbnail Creation (Python)/005 Setting up DynamoDB for Saving Thumbnail Metadata.mp4	79.2 MB
Showing first 1 matched files of 647 total files

LiveLessons - Amazon Web Services (AWS), 3rd Edition		4.0 GB	DOWNLOAD

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics en.srt	3.0 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics.mp4	9.6 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features en.srt	4.6 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features.mp4	11.5 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/004. 15.3 Demo Deploy a DynamoDB Table (Console) en.srt	7.3 KB
Showing first 5 matched files of 498 total files

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program		7.1 GB	DOWNLOAD

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4	134.7 MB
Showing first 1 matched files of 72 total files

Amazon Web Services (AWS), 3rd Edition		4.0 GB	DOWNLOAD

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics en.srt	3.0 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics.mp4	9.6 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features en.srt	4.6 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features.mp4	11.5 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/004. 15.3 Demo Deploy a DynamoDB Table (Console) en.srt	7.3 KB
Showing first 5 matched files of 494 total files

Kingdoms Reborn		3.7 GB	DOWNLOAD

/PunCity/Binaries/Win64/aws-cpp-sdk-dynamodb.dll	1.0 MB
Showing first 1 matched files of 74 total files

Imersão DotNet Expert - Luis Dev		88.1 GB	DOWNLOAD

/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/01 - O que é DynamoDB.mp4	10.2 MB
/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/02 - Elementos e Operações do DynamoDB.mp4	18.4 MB
/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/03 - Criando tabela e executando Query e Scan.mp4	38.4 MB
/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/04 - Tipos de Índices - GSI vs LSI.mp4	44.9 MB
Showing first 4 matched files of 1124 total files

[Yan Cui] AppSync Masterclass (Premium) (2023)		7.4 GB	DOWNLOAD

/3. Chapter 2 - AWS 101/3.2. DynamoDB 101.mp4	10.5 MB
/5. Chapter 4 - Building an AppSync backend -part 1-/5.25. Use context.info to remove unnecessary DynamoDB calls.mp4	29.7 MB
Showing first 2 matched files of 202 total files

Land of the Vikings		8.0 GB	DOWNLOAD

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-common.dll	148.0 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-event-stream.dll	25.6 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-checksums.dll	45.6 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-core.dll	1.1 MB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-dynamodb.dll	2.4 MB
Showing first 5 matched files of 60 total files

itpro.tv		163.2 GB	DOWNLOAD

/Amazom/AWS Certified Solutions Architect - Associate/7.3 - Amazon Dynamodb.mp4	154.8 MB
Showing first 1 matched files of 865 total files

[ DevCourseWeb.com ] Udemy - Building REST APIs with Serverless Framework on AWS		3.6 GB	DOWNLOAD

/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB.mp4	75.2 MB
/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB_en.vtt	7.6 KB
/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation.mp4	56.8 MB
/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation_en.vtt	6.7 KB
/~Get Your Files Here !/10 - Bonus!/002 DynamoDB Crash Course.mp4	592.9 MB
Showing first 5 matched files of 158 total files

AWS Cloud Security Bootcamp		10.3 GB	DOWNLOAD

/[TutsNode.net] - AWS Cloud Security Bootcamp/19. DynamoDB and other Cloud Databases Part 4.mp4	644.9 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/18. DynamoDB and other Cloud Databases Part 3.mp4	443.9 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/17. DynamoDB and other Cloud Databases Part 2.mp4	317.8 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/16. DynamoDB and other Cloud Databases Part 1.mp4	190.9 MB
Showing first 4 matched files of 51 total files

Software Architecture & Technology of Large-Scale Systems		6.2 GB	DOWNLOAD

/07 - Technology Stack/034 Amazon DynamoDB.mp4	37.5 MB
/07 - Technology Stack/034 Amazon DynamoDB_en.srt	12.2 KB
/07 - Technology Stack/035 DynamoDB architecture.mp4	49.8 MB
/07 - Technology Stack/035 DynamoDB architecture_en.srt	14.9 KB
Showing first 4 matched files of 513 total files

Amazon Web Services in Action, Third Edition, Video Edition		2.0 GB	DOWNLOAD

/079. Chapter 12. Programming for the NoSQL database service DynamoDB.mp4	23.2 MB
/087. Chapter 12. DynamoDB Local.mp4	2.7 MB
/088. Chapter 12. Operating DynamoDB.mp4	5.9 MB
/091. Chapter 12. Comparing DynamoDB to RDS.mp4	6.8 MB
Showing first 4 matched files of 120 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata		6.7 GB	DOWNLOAD

/3. Domain 2 Storage/12. DynamoDB Overview.mp4	36.7 MB
/3. Domain 2 Storage/12. DynamoDB Overview.srt	11.0 KB
/3. Domain 2 Storage/13. DynamoDB RCU & WCU.mp4	55.8 MB
/3. Domain 2 Storage/13. DynamoDB RCU & WCU.srt	14.9 KB
/3. Domain 2 Storage/14. DynamoDB Partitions.mp4	19.9 MB
Showing first 5 matched files of 612 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!		10.3 GB	DOWNLOAD

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv	68.1 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv	109.9 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv	6.2 MB
Showing first 3 matched files of 242 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!		10.3 GB	DOWNLOAD

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv	68.1 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv	109.9 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv	6.2 MB
Showing first 3 matched files of 234 total files

[Tutorialsplanet.NET] Udemy - HashiCorp Certified Terraform Associate 2023		7.0 GB	DOWNLOAD

/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Bulgarian.srt	13.4 KB
/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Czech.srt	8.3 KB
/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Danish.srt	8.5 KB
/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking Dutch.srt	8.6 KB
/7 - Remote State Management/84 - Integrating DynamoDB with S3 for state locking English.srt	9.9 KB
Showing first 5 matched files of 1798 total files

Ignite 4.0 - Rocketseat		76.9 GB	DOWNLOAD

/Node/Chapter VI/02 - Serverless/01 - Serverless/05 - Conhecendo o DynamoDB - Rocketseat[3].mp4	43.3 MB
/Node/Chapter VI/02 - Serverless/01 - Serverless/06 - Configurando o DynamoDB - Rocketseat[3].mp4	157.8 MB
Showing first 2 matched files of 638 total files

«« « Back Next » »»

Copyright © 2025 FileMood.com