dynamodb | 80 to 99 | Download files with FileMood

Welcome Guest
Log In
Register

Showing results 80 to 99 of about 467 for dynamodb

Serverless Fullstack with AWS-CDK-NextJS & Typescript		5.5 GB	DOWNLOAD

/Chapter 07 Database/003. Adding DynamoDB in CDK.en.srt	22.1 KB
/Chapter 07 Database/003. Adding DynamoDB in CDK.mp4	87.0 MB
/Chapter 07 Database/004. DynamoDB SDK.en.srt	12.2 KB
/Chapter 07 Database/004. DynamoDB SDK.mp4	53.7 MB
/Chapter 08 Lambda Layers/006. DynamoDB Layer.en.srt	16.1 KB
Showing first 5 matched files of 172 total files

GetFreeCourses.Co-Udemy-AWS Lambda and the Serverless Framework - Hands On Learning!		5.5 GB	DOWNLOAD

/10 - [Hands-on] - Real World Example Service - 1 - Thumbnail Creation (Python)/005 Setting up DynamoDB for Saving Thumbnail Metadata.mp4	79.2 MB
Showing first 1 matched files of 647 total files

CBTNuggets - AWS DVA-C02 Online Training 2023-5		15.8 GB	DOWNLOAD

/3. Extend AWS Lambda Functionality and Deployments/3. DynamoDB Destinations - AWS Certified Developer - Associate (DVA-C02) CBT Nuggets-1.mp4	109.1 MB
/12. Understand and Deploy Caching in AWS/5. Deploy and Load a DynamoDB Table - AWS Certified Developer - Associate (DVA-C02) CBT Nuggets-1.mp4	42.0 MB
/13. Understand and Deploy AWS DynamoDB/1. Introducing DynamoDB - AWS Certified Developer - Associate (DVA-C02) CBT Nuggets.mp4	36.8 MB
/13. Understand and Deploy AWS DynamoDB/2. When to Use DynamoDB - AWS Certified Developer - Associate (DVA-C02) CBT Nuggets.mp4	79.6 MB
/13. Understand and Deploy AWS DynamoDB/3. Partition Keys and Sort Keys - AWS Certified Developer - Associate (DVA-C02) CBT Nuggets-1.mp4	79.2 MB
Showing first 5 matched files of 244 total files

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program		7.1 GB	DOWNLOAD

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4	134.7 MB
Showing first 1 matched files of 72 total files

[FreeCoursesOnline.Me] LiveLessons - Amazon Web Services (AWS), 3rd Edition		4.0 GB	DOWNLOAD

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics en.srt	3.0 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics.mp4	9.6 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features en.srt	4.6 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features.mp4	11.5 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/004. 15.3 Demo Deploy a DynamoDB Table (Console) en.srt	7.3 KB
Showing first 5 matched files of 498 total files

Amazon Web Services (AWS), 3rd Edition		4.0 GB	DOWNLOAD

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics en.srt	3.0 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics.mp4	9.6 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features en.srt	4.6 KB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features.mp4	11.5 MB
/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/004. 15.3 Demo Deploy a DynamoDB Table (Console) en.srt	7.3 KB
Showing first 5 matched files of 494 total files

Kingdoms Reborn		3.7 GB	DOWNLOAD

/PunCity/Binaries/Win64/aws-cpp-sdk-dynamodb.dll	1.0 MB
Showing first 1 matched files of 74 total files

[ CourseHulu.com ] Egghead - Build a GraphQL API with AWS CDK and AppSync		291.8 MB	DOWNLOAD

/~Get Your Files Here !/06-egghead-11-16-21-create-a-dynamodb-table-to-store-books-KURjT8Bll.mp4	21.6 MB
/~Get Your Files Here !/07-egghead-11-16-21-read-data-from-a-dynamodb-table-in-a-lambda-resolver-SoQnXL1k9.mp4	22.9 MB
Showing first 2 matched files of 18 total files

Land of the Vikings		8.0 GB	DOWNLOAD

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-common.dll	148.0 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-event-stream.dll	25.6 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-checksums.dll	45.6 KB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-core.dll	1.1 MB
/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-dynamodb.dll	2.4 MB
Showing first 5 matched files of 60 total files

[ DevCourseWeb.com ] Udemy - Amazon DynamoDB - Advanced Developer's Guide		2.8 GB	DOWNLOAD

/~Get Your Files Here !/12. Data Resilience , Security and Encryption/3. DynamoDB VPC endpoints.mp4	45.3 MB
/~Get Your Files Here !/14. Node.js and DynamoDB/1. Creating tables in DynamoDB using Node.js.mp4	51.7 MB
/~Get Your Files Here !/14. Node.js and DynamoDB/2. Inserting data into DynamoDB using Node.js.mp4	22.2 MB
/~Get Your Files Here !/14. Node.js and DynamoDB/3. Querying data using Node.js.mp4	21.3 MB
/~Get Your Files Here !/14. Node.js and DynamoDB/4. Understanding Streams.mp4	50.9 MB
Showing first 5 matched files of 3303 total files

[ DevCourseWeb.com ] Udemy - Building REST APIs with Serverless Framework on AWS		3.6 GB	DOWNLOAD

/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB.mp4	75.2 MB
/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB_en.vtt	7.6 KB
/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation.mp4	56.8 MB
/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation_en.vtt	6.7 KB
/~Get Your Files Here !/10 - Bonus!/002 DynamoDB Crash Course.mp4	592.9 MB
Showing first 5 matched files of 158 total files

AWS Cloud Security Bootcamp		10.3 GB	DOWNLOAD

/[TutsNode.net] - AWS Cloud Security Bootcamp/19. DynamoDB and other Cloud Databases Part 4.mp4	644.9 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/18. DynamoDB and other Cloud Databases Part 3.mp4	443.9 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/17. DynamoDB and other Cloud Databases Part 2.mp4	317.8 MB
/[TutsNode.net] - AWS Cloud Security Bootcamp/16. DynamoDB and other Cloud Databases Part 1.mp4	190.9 MB
Showing first 4 matched files of 51 total files

Software Architecture & Technology of Large-Scale Systems		6.2 GB	DOWNLOAD

/07 - Technology Stack/034 Amazon DynamoDB.mp4	37.5 MB
/07 - Technology Stack/034 Amazon DynamoDB_en.srt	12.2 KB
/07 - Technology Stack/035 DynamoDB architecture.mp4	49.8 MB
/07 - Technology Stack/035 DynamoDB architecture_en.srt	14.9 KB
Showing first 4 matched files of 513 total files

Amazon Web Services in Action, Third Edition, Video Edition		2.0 GB	DOWNLOAD

/079. Chapter 12. Programming for the NoSQL database service DynamoDB.mp4	23.2 MB
/087. Chapter 12. DynamoDB Local.mp4	2.7 MB
/088. Chapter 12. Operating DynamoDB.mp4	5.9 MB
/091. Chapter 12. Comparing DynamoDB to RDS.mp4	6.8 MB
Showing first 4 matched files of 120 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata		6.7 GB	DOWNLOAD

/3. Domain 2 Storage/12. DynamoDB Overview.mp4	36.7 MB
/3. Domain 2 Storage/12. DynamoDB Overview.srt	11.0 KB
/3. Domain 2 Storage/13. DynamoDB RCU & WCU.mp4	55.8 MB
/3. Domain 2 Storage/13. DynamoDB RCU & WCU.srt	14.9 KB
/3. Domain 2 Storage/14. DynamoDB Partitions.mp4	19.9 MB
Showing first 5 matched files of 612 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!		10.3 GB	DOWNLOAD

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv	68.1 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv	109.9 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv	6.2 MB
Showing first 3 matched files of 242 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!		10.3 GB	DOWNLOAD

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv	68.1 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv	109.9 MB
/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv	6.2 MB
Showing first 3 matched files of 234 total files

Ignite 4.0 - Rocketseat		76.9 GB	DOWNLOAD

/Node/Chapter VI/02 - Serverless/01 - Serverless/05 - Conhecendo o DynamoDB - Rocketseat[3].mp4	43.3 MB
/Node/Chapter VI/02 - Serverless/01 - Serverless/06 - Configurando o DynamoDB - Rocketseat[3].mp4	157.8 MB
Showing first 2 matched files of 638 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009		9.6 GB	DOWNLOAD

/5. Databases On AWS/5. DynamoDB.mp4	41.0 MB
/5. Databases On AWS/5. DynamoDB.srt	6.3 KB
/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].mp4	66.7 MB
/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].srt	23.0 KB
Showing first 4 matched files of 696 total files

UD1		5.3 GB	DOWNLOAD

/03 Domain 2 Storage/036 DynamoDB Overview.mp4	36.7 MB
/03 Domain 2 Storage/037 DynamoDB RCU WCU.mp4	55.8 MB
/03 Domain 2 Storage/038 DynamoDB Partitions.mp4	19.9 MB
/03 Domain 2 Storage/039 DynamoDB APIs.mp4	46.2 MB
/03 Domain 2 Storage/040 DynamoDB Indexes LSI GSI.mp4	27.4 MB
Showing first 5 matched files of 138 total files

«« « Back Next » »»

Copyright © 2025 FileMood.com