FileMood

Showing results 82 to 101 of about 467 for dynamodb

PacktPub - Amazon Web Services (AWS) Technical Essentials - Ultimate Training Program

7.1 GB

/51-Amazon Aurora, DynamoDB, Redshift and ElastiCache.mp4

134.7 MB

 

Showing first 1 matched files of 72 total files

Amazon Web Services (AWS), 3rd Edition

4.0 GB

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics en.srt

3.0 KB

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/002. 15.1 Amazon DynamoDB Basics.mp4

9.6 MB

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features en.srt

4.6 KB

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/003. 15.2 Amazon DynamoDB Features.mp4

11.5 MB

/Module 6 AWS Database Services/Lesson 15 AWS NoSQL Database Services/004. 15.3 Demo Deploy a DynamoDB Table (Console) en.srt

7.3 KB

 

Showing first 5 matched files of 494 total files

Kingdoms Reborn

3.7 GB

/PunCity/Binaries/Win64/aws-cpp-sdk-dynamodb.dll

1.0 MB

 

Showing first 1 matched files of 74 total files

Imersão DotNet Expert - Luis Dev

88.1 GB

/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/01 - O que é DynamoDB.mp4

10.2 MB

/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/02 - Elementos e Operações do DynamoDB.mp4

18.4 MB

/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/03 - Criando tabela e executando Query e Scan.mp4

38.4 MB

/04 - Computação na Nuvem/5 - Serverless com AWS e .NET/03 - DynamoDB/04 - Tipos de Índices - GSI vs LSI.mp4

44.9 MB

 

Showing first 4 matched files of 1124 total files

Infra e DevOps

110.4 GB

/_[PACK] Alura Escola DevOps, Embarcados e Robótica - Diversos Autores/Raspberry Pi Autenticação com RFID e Dynamo DB/5- DynamoDB na AWS/2.mp4

48.2 MB

/_[PACK] Alura Escola DevOps, Embarcados e Robótica - Diversos Autores/Raspberry Pi Autenticação com RFID e Dynamo DB/5- DynamoDB na AWS/4.mp4

78.3 MB

/_[PACK] Alura Escola DevOps, Internet das coisas - Diversos Autores/Amazon IoT Conecte dispositivos à nuvem e defina regras de notificação/3- Usando Amazon DynamoDB e definindo as primeiras regras/1.mp4

92.3 MB

/_[PACK] Alura Escola DevOps, Internet das coisas - Diversos Autores/Amazon IoT Conecte dispositivos à nuvem e defina regras de notificação/3- Usando Amazon DynamoDB e definindo as primeiras regras/4.mp4

29.6 MB

 

Showing first 4 matched files of 2061 total files

[Yan Cui] AppSync Masterclass (Premium) (2023)

7.4 GB

/3. Chapter 2 - AWS 101/3.2. DynamoDB 101.mp4

10.5 MB

/5. Chapter 4 - Building an AppSync backend -part 1-/5.25. Use context.info to remove unnecessary DynamoDB calls.mp4

29.7 MB

 

Showing first 2 matched files of 202 total files

Land of the Vikings

8.0 GB

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-common.dll

148.0 KB

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-c-event-stream.dll

25.6 KB

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-checksums.dll

45.6 KB

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-core.dll

1.1 MB

/Engine/Plugins/Marketplace/AwsDynamoDB/Source/ThirdParty/AwsDynamoDBLibrary/Bin/Win64/aws-cpp-sdk-dynamodb.dll

2.4 MB

 

Showing first 5 matched files of 60 total files

itpro.tv

163.2 GB

/Amazom/AWS Certified Solutions Architect - Associate/7.3 - Amazon Dynamodb.mp4

154.8 MB

 

Showing first 1 matched files of 865 total files

[ DevCourseWeb.com ] Udemy - Building REST APIs with Serverless Framework on AWS

3.6 GB

/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB.mp4

75.2 MB

/~Get Your Files Here !/02 - Serverless Fundamentals/005 Introduction to Amazon DynamoDB_en.vtt

7.6 KB

/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation.mp4

56.8 MB

/~Get Your Files Here !/03 - Building a Serverless REST API/008 Creating a DynamoDB table with CloudFromation_en.vtt

6.7 KB

/~Get Your Files Here !/10 - Bonus!/002 DynamoDB Crash Course.mp4

592.9 MB

 

Showing first 5 matched files of 158 total files

AWS Cloud Security Bootcamp

10.3 GB

/[TutsNode.net] - AWS Cloud Security Bootcamp/19. DynamoDB and other Cloud Databases Part 4.mp4

644.9 MB

/[TutsNode.net] - AWS Cloud Security Bootcamp/18. DynamoDB and other Cloud Databases Part 3.mp4

443.9 MB

/[TutsNode.net] - AWS Cloud Security Bootcamp/17. DynamoDB and other Cloud Databases Part 2.mp4

317.8 MB

/[TutsNode.net] - AWS Cloud Security Bootcamp/16. DynamoDB and other Cloud Databases Part 1.mp4

190.9 MB

 

Showing first 4 matched files of 51 total files

Software Architecture & Technology of Large-Scale Systems

6.2 GB

/07 - Technology Stack/034 Amazon DynamoDB.mp4

37.5 MB

/07 - Technology Stack/034 Amazon DynamoDB_en.srt

12.2 KB

/07 - Technology Stack/035 DynamoDB architecture.mp4

49.8 MB

/07 - Technology Stack/035 DynamoDB architecture_en.srt

14.9 KB

 

Showing first 4 matched files of 513 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer - Professional 2023

14.7 GB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/155 - Core Components of DynamoDB English.vtt

5.9 KB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/155 - Core Components of DynamoDB.mp4

36.2 MB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/156 - DynamoDB Consistency Model English.vtt

7.5 KB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/156 - DynamoDB Consistency Model.mp4

55.6 MB

/7 - Domain 6 High Availability Fault Tolerance and Disaster Recovery/158 - Capacity Modes in DynamoDB English.vtt

7.0 KB

 

Showing first 5 matched files of 437 total files

[FreeCourseSite.com] Udemy - AWS Certified Developer Associate Exam Training DVA-C02

4.4 GB

/08 - Amazon DynamoDB/001 Introduction.mp4

8.7 MB

/08 - Amazon DynamoDB/001 Introduction_en.srt

2.1 KB

/08 - Amazon DynamoDB/002 Amazon DynamoDB.mp4

85.7 MB

/08 - Amazon DynamoDB/002 Amazon DynamoDB_en.srt

12.3 KB

/08 - Amazon DynamoDB/003 DynamoDB Partitions and Primary Keys.mp4

15.4 MB

 

Showing first 5 matched files of 411 total files

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/079. Chapter 12. Programming for the NoSQL database service DynamoDB.mp4

23.2 MB

/087. Chapter 12. DynamoDB Local.mp4

2.7 MB

/088. Chapter 12. Operating DynamoDB.mp4

5.9 MB

/091. Chapter 12. Comparing DynamoDB to RDS.mp4

6.8 MB

 

Showing first 4 matched files of 120 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/12. DynamoDB Overview.mp4

36.7 MB

/3. Domain 2 Storage/12. DynamoDB Overview.srt

11.0 KB

/3. Domain 2 Storage/13. DynamoDB RCU & WCU.mp4

55.8 MB

/3. Domain 2 Storage/13. DynamoDB RCU & WCU.srt

14.9 KB

/3. Domain 2 Storage/14. DynamoDB Partitions.mp4

19.9 MB

 

Showing first 5 matched files of 612 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv

68.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv

109.9 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv

6.2 MB

 

Showing first 3 matched files of 242 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv

68.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv

109.9 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv

6.2 MB

 

Showing first 3 matched files of 234 total files

Ignite 4.0 - Rocketseat

76.9 GB

/Node/Chapter VI/02 - Serverless/01 - Serverless/05 - Conhecendo o DynamoDB - Rocketseat[3].mp4

43.3 MB

/Node/Chapter VI/02 - Serverless/01 - Serverless/06 - Configurando o DynamoDB - Rocketseat[3].mp4

157.8 MB

 

Showing first 2 matched files of 638 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/5. DynamoDB.mp4

41.0 MB

/5. Databases On AWS/5. DynamoDB.srt

6.3 KB

/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].mp4

66.7 MB

/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].srt

23.0 KB

 

Showing first 4 matched files of 696 total files

AWS Certified Cloud Practitioner - Complete NEW Course 2021

6.1 GB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-fr_FR.srt

8.0 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-de_DE.srt

7.9 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-id_ID.srt

7.6 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-es_ES.srt

7.4 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-it_IT.srt

7.4 KB

 

Showing first 5 matched files of 1644 total files


Copyright © 2025 FileMood.com